SecReT6
Protein ID: 378766697
SecReT6 ID536
T6SS typei3
Gene symbolhcp5
Locus tagPANA5342_1730
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1831205..1831687 [+]
Producttype VI secretion system effector
NoteTssD
UniProt IDG9AQT2
KEGG IDplf:PANA5342_1730
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-39, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|378766697|ref|YP_005195160.1| type VI secretion system effector [Pantoea ananatis LMG 5342]
MAIDMYLKVDGITGESKDSNHTGWIDITSFSWGANQPGNMSVGGGGGAGKVNFNDLHINAKIDKAVTALL
KNCASGKHVTKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSEHDDTLGVTYAFQAAKVKQQYWEQSS
SGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1831205-1831687 Pantoea ananatis LMG 5342, complete genome
ATGGCTATTGATATGTATTTGAAGGTAGACGGTATTACTGGTGAATCTAAAGATTCAAACCATACCGGCT
GGATTGATATTACCTCTTTCTCCTGGGGCGCTAATCAGCCGGGTAATATGAGCGTGGGCGGCGGCGGCGG
TGCTGGTAAAGTAAACTTCAACGACCTGCACATTAATGCCAAAATCGACAAGGCTGTCACTGCGCTGTTG
AAAAACTGTGCCAGTGGTAAGCACGTCACTAAGGTTGAAGTTTCAGTTTGCAAGGCTGGCGGTACGCAAA
TCGAGTACACCCGCATCACCCTGGAAGACGTGCTGGTCACCAACGTACAGTTCGTGGGCTCTGAGCACGA
TGATACGCTGGGCGTAACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGAGCTCT
TCTGGCGGTAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATCAAAGAGAATAAAGAAGCGTAA