SecReT6
Protein ID: 378766705
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1738
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1839651..1840478 [+]
Producttype VI secretion system-associated hypothetical protein
NoteTagJ
UniProt IDG9AQU0
KEGG IDplf:PANA5342_1738
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.90E-41, Aligned region: 144..265
Protein Sequence: 275 a.a.     [Download]
>gi|378766705|ref|YP_005195168.1| type VI secretion system-associated hypothetical protein [Pantoea ananatis LMG 5342]
MDSLQQRLANATLAENLSSITAQIQANPADADLRAAFVQLLCLDGNWSRAQTQLKSWLAMLPQAQPTVTL
LQQAIEGEQKRAAVLRGEAEPQLPGSAWPWCQVLLAALKADIAGDKAVGAALRAQALESAEASAGTATTQ
EGESPFAWIMDGDSRFGPVCEAIANGHYYWIPFAAISEIEFQAPASVTDLVWRHTRLQLVDGSEQICQIP
VRYPLQDKADERFLRASVTEWQESGSDDGQFIGHGQKMWLSDEADYPLLTLQQLIFNETELPHES
 
Nucleotide Sequence: 828 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1839651-1840478 Pantoea ananatis LMG 5342, complete genome
ATGGACTCATTACAACAGCGACTGGCCAATGCTACCCTGGCGGAAAACCTGTCCAGCATCACTGCACAAA
TCCAGGCGAATCCGGCTGATGCGGATTTACGGGCGGCATTTGTGCAACTCCTGTGCCTTGACGGTAACTG
GAGCAGGGCGCAGACACAGCTGAAATCCTGGCTGGCCATGCTGCCTCAGGCGCAGCCCACCGTGACCTTG
CTGCAACAGGCTATTGAGGGCGAACAGAAACGTGCAGCGGTTTTGCGCGGTGAAGCCGAGCCGCAACTGC
CAGGAAGCGCCTGGCCGTGGTGCCAGGTCTTACTGGCCGCGCTGAAAGCGGACATAGCGGGCGATAAGGC
CGTCGGTGCGGCACTGCGTGCTCAGGCGCTGGAAAGCGCAGAGGCGAGCGCCGGTACGGCCACAACCCAG
GAGGGGGAAAGCCCGTTCGCCTGGATAATGGACGGTGACAGCCGCTTCGGACCGGTCTGTGAAGCCATCG
CCAATGGACACTATTACTGGATCCCGTTTGCTGCCATCAGCGAAATAGAGTTTCAGGCTCCGGCAAGCGT
CACGGATCTGGTCTGGCGCCATACTCGCCTGCAGCTGGTGGACGGAAGTGAGCAAATTTGTCAGATTCCG
GTGCGCTACCCGCTTCAGGACAAGGCTGATGAACGCTTTCTGCGGGCAAGCGTAACGGAGTGGCAGGAAT
CAGGCAGCGATGACGGTCAGTTTATCGGTCACGGGCAAAAGATGTGGCTCAGCGATGAAGCAGATTATCC
CTTACTGACGCTGCAGCAGCTTATTTTCAACGAAACTGAGTTACCTCATGAGTCGTAA