SecReT6
Protein ID: 378766706
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1739
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1840468..1841043 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDG9AQU1
KEGG IDplf:PANA5342_1739
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-19, Aligned region: 60..170
Protein Sequence: 191 a.a.     [Download]
>gi|378766706|ref|YP_005195169.1| type VI secretion system lysozyme-like protein [Pantoea ananatis LMG 5342]
MSRNDNSSGDGYSQLHGGYRARKNRDTLTARDKLQSSLLDRLTDDAPDKTTESGNSSIITHSTLRRNVLR
DLQWLFNTINNEAQHDLSDLTEVQRSVLNFGVAPLAGQNISDIEWQDMQRKMTDAILHFEPRILPQGLQV
RCVSDLTSLSLHNVLSIEIKGRLWCVPYPLEFLFRTQVDLESGHFELQDAG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1840468-1841043 Pantoea ananatis LMG 5342, complete genome
ATGAGTCGTAATGACAATTCGTCCGGTGACGGCTATTCGCAGCTGCATGGCGGCTATCGTGCGCGCAAAA
ATCGCGACACGCTGACGGCGCGTGACAAACTGCAGTCGTCCCTGCTGGACAGGCTGACAGACGACGCGCC
AGATAAAACCACCGAGTCAGGCAACAGTTCGATTATTACCCACAGTACGCTGCGGCGTAATGTTCTGCGC
GATCTCCAGTGGTTATTCAACACCATCAATAACGAGGCGCAGCACGATCTGAGCGACCTGACGGAGGTCC
AGCGTTCCGTGCTGAATTTTGGCGTGGCCCCCCTGGCCGGACAGAATATCTCGGACATCGAATGGCAGGA
TATGCAACGGAAAATGACCGATGCCATTCTGCACTTTGAGCCACGCATTTTACCCCAGGGCTTACAGGTT
CGCTGCGTAAGCGACCTGACCTCTCTGAGTCTGCACAACGTACTATCGATTGAGATTAAAGGCCGGTTAT
GGTGCGTGCCGTACCCGCTGGAGTTTCTGTTCCGCACTCAGGTTGATTTAGAGAGCGGCCATTTTGAACT
ACAGGATGCAGGTTAA