SecReT6
Protein ID: 378766707
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1740
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1841046..1842923 [+]
Producttype VI secretion system, core protein
NoteTssF
UniProt IDG9AQU2
KEGG IDplf:PANA5342_1740
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-211, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|378766707|ref|YP_005195170.1| type VI secretion system, core protein [Pantoea ananatis LMG 5342]
MDSKLLDYYNRELAYLREMGAEFAAQYPKVAGRLGMRGIDVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRMLEMVAPGYLSPTPSMAIAQLTPDSRKGDISNGFLVPRGTMMESQNLKKTGVTCSYTTAHDVMLQP
LRISDVSLGGVPADIPLGELKAGGSTAASSALRIRITCEGISSLSQLSLDDVMFFLSGPDIQALKLMELL
MQHRVGIILQSVEAKPQRQVLPDDALQQEGFSTEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLRQLA
PFLQRCDNALSFDIVILLDKADAALESVVDSAHLALHCTPVINLFPKTAERLKVSDSQHEYHLVVDNIRP
LDYEIHSVKRLFASVEGQREEQIFRPFWSTFSHDGGDYGAYFSLRREQRTLSEHALRYGTRTGYIGSEVF
LSLVDQNHTPWNSDIRYLSAEVMCTSRDLPLMLLQQEQANFVMPDSIPVGQLKLCKGPTPPRPALAEGLS
AWRLISHLQMNYLSLMDSSDGEGAAALRQMLSLYASLAETPLTRQIDGIRHCNLKAVHRRVPEPGPVVFA
RGVSIALEVDEQAFSGASPWLFGSVLERVFSRLVALNSFTEFTLSSQQRGEVGYWPPRMGKKALL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1841046-1842923 Pantoea ananatis LMG 5342, complete genome
ATGGACAGCAAGCTGCTTGATTACTACAACCGTGAACTGGCCTATCTGCGCGAGATGGGCGCGGAGTTTG
CTGCCCAGTATCCCAAGGTCGCCGGGCGGCTTGGTATGCGCGGCATTGACGTCGCCGATCCTTACGTCGA
AAGACTTATGGAGGGTTTCGCATTTCTGACGTCACGCGTGCAGTTAAAGATGGATGCCGAGTTTCCACGC
TTTTCTCAGCGGATGCTGGAAATGGTGGCACCGGGCTACCTTTCACCTACGCCGTCGATGGCCATCGCCC
AGCTCACGCCGGACAGCCGCAAAGGCGATATCAGCAACGGTTTCTTAGTGCCGCGCGGCACAATGATGGA
AAGCCAGAACCTGAAAAAAACGGGCGTCACCTGCAGCTATACCACCGCGCACGATGTGATGTTACAGCCC
CTGCGTATCAGCGATGTGTCGTTAGGTGGCGTGCCAGCGGATATCCCGTTAGGCGAGTTGAAAGCGGGCG
GCTCGACGGCGGCGTCCAGCGCCCTCCGTATCCGCATCACCTGCGAAGGCATTTCATCGTTAAGCCAGCT
CAGTCTCGATGACGTGATGTTTTTCCTGAGCGGACCCGATATCCAGGCCCTGAAACTGATGGAGCTGCTG
ATGCAGCATCGTGTCGGAATCATCCTGCAGTCCGTGGAAGCAAAACCGCAACGTCAGGTTCTGCCGGATG
ACGCGCTTCAACAGGAAGGCTTTTCGACCGAGCAGGCCCTGCTGCCCGACGATCTGCGTAATTTTGACGG
CTACCGCCTGCTGCAGGAGTATTTTGCATTCCCGGCACGCTTCCAGTTTATCAGCCTGCGTCAGCTGGCG
CCTTTCCTGCAGCGCTGCGATAACGCCCTGTCGTTTGATATCGTCATCCTGCTGGATAAGGCCGATGCGG
CGCTGGAAAGCGTTGTCGACAGCGCCCATCTGGCCCTGCACTGCACGCCGGTCATTAACCTGTTCCCGAA
AACCGCCGAGCGGCTTAAGGTCAGCGACAGTCAGCACGAGTATCACCTGGTGGTCGATAACATTCGTCCG
CTGGACTATGAGATCCATTCGGTGAAGCGCTTGTTCGCCTCTGTCGAAGGGCAGCGCGAAGAGCAGATCT
TCCGGCCGTTCTGGAGCACCTTCAGCCATGACGGCGGGGATTATGGCGCGTATTTCTCCCTGCGTCGTGA
ACAGCGCACGCTCTCTGAGCACGCGTTGCGCTATGGCACCCGAACGGGCTATATCGGTTCTGAAGTGTTT
CTCTCCTTGGTGGATCAAAATCATACACCGTGGAACAGCGATATCCGCTATTTGTCTGCGGAAGTGATGT
GCACCAGCCGTGACCTGCCTTTGATGCTGCTACAGCAAGAGCAGGCCAACTTTGTAATGCCGGATTCCAT
TCCTGTCGGGCAACTTAAATTGTGCAAAGGCCCGACGCCACCGCGTCCGGCGCTGGCTGAAGGGCTTTCA
GCATGGCGACTCATCAGTCATCTGCAGATGAACTATCTAAGCCTGATGGACAGCAGCGATGGCGAAGGGG
CTGCGGCACTGCGCCAGATGCTGAGCCTGTATGCCAGCCTGGCCGAAACGCCGCTAACGCGTCAGATTGA
CGGAATTCGGCACTGCAACCTCAAAGCCGTTCACCGCCGGGTGCCCGAGCCGGGCCCCGTGGTGTTTGCG
CGCGGGGTCAGCATTGCGCTTGAGGTGGATGAGCAGGCGTTTTCAGGTGCCAGCCCCTGGCTGTTCGGCA
GCGTGCTGGAGCGGGTCTTTTCTCGCCTTGTGGCGCTTAACAGCTTTACCGAATTCACCCTGAGCAGCCA
GCAGCGCGGCGAAGTGGGCTACTGGCCGCCGCGCATGGGCAAAAAGGCGCTGCTATGA