SecReT6
Protein ID: 378766708
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1741
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1842920..1843969 [+]
Producttype VI secretion system, core protein
NoteTssG
UniProt IDG9AQU3
KEGG IDplf:PANA5342_1741
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.80E-107, Aligned region: 26..330
Protein Sequence: 349 a.a.     [Download]
>gi|378766708|ref|YP_005195171.1| type VI secretion system, core protein [Pantoea ananatis LMG 5342]
MSETAHVIPLQRAVRLPDGFWQAVMAAPWRYDLFQLLRKLDAQSGQRYALGKAPLPKFEAVRLGQKPSLA
FAPSTVSQVKAREQDERYDVSIYSFGLFGPNGPLPTHLTEYVRGRIDHHQDHSLSAFADLFHHRATLLFY
RAWANSQPTSSLDRRDDRRFQDYLACVAGIGLPAQQKASSLSLHARLMLSGHLSRHGHDAEGLVRILRHY
FAVPVKLQQNVPQWLSLDSRDQARLSAGRHMPRLGESAFLGVAVRDVQHRFRLRIGPLSAEQYERFLPNA
QGACEVRDWVRHYLGIEMQWDLSLILAADAVKGVTLGGQARLGYTSWLGQQPQPVDREDFAFEVEATPS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1842920-1843969 Pantoea ananatis LMG 5342, complete genome
ATGAGTGAGACGGCGCACGTTATTCCCCTACAGCGGGCGGTGCGTCTGCCTGACGGTTTCTGGCAGGCCG
TGATGGCCGCGCCCTGGCGCTATGATCTGTTTCAGCTGCTACGCAAGCTGGACGCCCAGAGTGGGCAGCG
TTATGCCTTAGGTAAAGCGCCACTGCCCAAATTTGAGGCCGTGCGTCTTGGGCAAAAGCCATCCCTGGCC
TTTGCACCGTCGACCGTGTCACAGGTTAAAGCGCGTGAGCAGGACGAACGCTACGACGTCTCCATTTACA
GCTTTGGGCTGTTTGGTCCCAACGGTCCTCTCCCTACGCACCTGACGGAATATGTACGGGGACGTATCGA
TCACCATCAGGATCACAGCCTGAGCGCTTTCGCCGATCTGTTTCATCATCGTGCCACGCTGCTGTTCTAC
CGTGCCTGGGCTAATTCACAGCCAACCAGCTCCCTGGATCGCCGCGACGATCGGCGGTTTCAGGATTATC
TGGCCTGCGTGGCCGGTATTGGGTTACCGGCCCAGCAGAAAGCCAGTTCGCTGAGTCTGCATGCGCGCCT
CATGCTGTCAGGGCATCTCAGCCGCCACGGTCACGATGCCGAAGGGCTGGTACGCATTTTGCGTCACTAC
TTTGCCGTTCCGGTTAAGCTGCAACAGAACGTGCCGCAGTGGTTATCCCTGGACAGCCGCGATCAGGCCC
GTCTGTCGGCCGGTCGCCATATGCCGCGCCTGGGTGAATCGGCCTTTCTCGGTGTGGCCGTTCGTGATGT
ACAGCATCGTTTTCGTCTGCGCATCGGTCCACTGAGCGCCGAGCAGTACGAACGTTTTTTACCCAACGCG
CAGGGCGCTTGCGAAGTGCGTGACTGGGTGCGCCACTATCTGGGTATTGAGATGCAGTGGGATCTCAGCC
TGATTCTGGCAGCCGATGCCGTTAAGGGCGTAACCCTTGGCGGTCAGGCGCGGCTGGGCTACACCAGTTG
GCTTGGACAGCAACCGCAGCCTGTCGATCGTGAAGATTTTGCCTTTGAGGTTGAAGCTACGCCGTCATAG