SecReT6
Protein ID: 378766711
SecReT6 ID536
T6SS typei3
Gene symbolvgrG1
Locus tagPANA5342_1744
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1848137..1850362 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG9AQU6
KEGG IDplf:PANA5342_1744
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-74, Aligned region: 23..330
Phage_base_V [PF04717], Evalue: 9.90E-26, Aligned region: 368..461
Protein Sequence: 741 a.a.     [Download]
>gi|378766711|ref|YP_005195174.1| ImpA family type VI secretion-associated protein [Pantoea ananatis LMG 5342]
MSSRITVQLPAEGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPTDGLLSAVNPRYI
NGKITQIGVRSEELGGVRYAVYGLTVEPDLWPMKRDRNLRIFQSQTVPQIVQTLLKEYGVNVETRLAGSY
RVWEYCVQYQESSFDFISRLMELEGMYYFFRHEADKHTLVLCDAPDQHQAFPGYETIAYHVTPSGGSVTE
EGVSQWALSESVTPGMYSTDDYDFRKPNAWMLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIRQE
VWQVEHHMVSGSGTATGIAPGYTFALLNAPHFSDNGKYLVTSAHYDFEENSYASGDAGATRHNIDFTVLP
AAVTYRAKPETPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWDLPGDATRMGFMTRSKDGHQANASYLFFED
KPGGELLNMHAEKDMNISVENDKTVAIDGSRTTTIGKEQNDEVTGDATFHYKQKRTTTVDQLESNIFNNG
ESTEIKNGRKLNLKSGGDESNITGGQKLNLNGTREVTISNGDILNVQAEGRKQHINGNVEEEINGNVGVN
INGNWTQTVEGGTAFISSPNLIRIQSATKVEIDSPQGLYTNKGLNVSFNGASMSFNGISTSVNGTSISWT
PINMSTSLTSIVHSPMNHVRSLTKIESTMQNVAIGLLHMFI
 
Nucleotide Sequence: 2226 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1848137-1850362 Pantoea ananatis LMG 5342, complete genome
ATGTCCTCACGTATAACTGTGCAACTTCCCGCAGAAGGACTGCTGTTCCGACGTCTGAGCGGCAGCGAAG
CGCTGTCCCAGTCGTTCGTGCTGCAAGCGGAGCTGCTCTCCACCGACGCGCGCATTGACCGTAAGTCGCT
GCTGGGCAAGCCGGTCACTTTCACGCTGCCGACGGACGGTCTGCTGAGCGCGGTGAATCCGCGCTACATC
AACGGCAAAATCACGCAGATAGGCGTACGCAGCGAGGAGCTGGGCGGCGTGCGTTACGCGGTGTACGGGC
TGACGGTGGAGCCGGACCTGTGGCCGATGAAGCGCGACCGCAACCTGCGCATCTTCCAGAGCCAGACGGT
GCCGCAGATAGTGCAGACGCTGCTGAAGGAGTACGGAGTGAACGTGGAAACGCGCCTGGCGGGCAGTTAC
CGGGTGTGGGAATACTGCGTGCAGTATCAGGAGAGCAGCTTCGACTTTATCAGCCGGCTGATGGAGCTGG
AGGGGATGTACTACTTCTTCCGTCACGAGGCGGACAAGCACACGCTGGTGCTGTGCGACGCGCCGGACCA
GCATCAGGCGTTCCCGGGCTACGAAACGATAGCCTACCACGTGACGCCGTCGGGCGGCAGCGTGACGGAA
GAGGGCGTGAGCCAGTGGGCGCTGTCGGAAAGCGTGACGCCGGGGATGTACAGCACGGACGACTACGACT
TCCGCAAGCCGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGTGTCGCCGACCCCGGGCTCGGTGGA
CGTTTACGACTGGCCGGGTCGCTTCGTGGAGCACGGTCACGGCGAGTACTACGCGCGTATCCGCCAGGAG
GTGTGGCAGGTGGAGCACCACATGGTGAGCGGCAGCGGCACGGCGACGGGCATCGCGCCGGGCTACACTT
TCGCGCTGCTGAACGCACCGCACTTCAGCGACAACGGCAAATACCTGGTGACGTCGGCGCACTACGACTT
TGAAGAGAACAGCTACGCGAGCGGCGACGCGGGCGCCACGCGGCACAACATTGACTTCACGGTGCTGCCG
GCGGCGGTGACGTACCGTGCGAAGCCGGAGACGCCGTGGCCGAAGACGCACGGCCCGCAGACGGCGAAGG
TGGTGGGGCCGAAAGGCGAGAGCATCTGGACGGACAAATACGGCCGGGTGAAGGTGAAGTTCCACTGGGA
CCGTCTGGCGAAGGGCGACGACACCAGTTCGTGCTGGGTGCGCGTATCGAGCGCCTGGGCGGGTCAGGGC
TTCGGCGGGGTGCAGATCCCGCGCGTGGGCGATGAAGTCGTCGTCGATTTTATCAACGGCGATCCAGACC
GGCCAATTATTACTGGCCGTGTCTACAACGAAGCCAGCATGCCACCCTGGGATCTCCCCGGCGATGCTAC
ACGAATGGGCTTTATGACACGGAGTAAAGACGGACATCAGGCCAATGCCAGCTATCTGTTCTTTGAAGAT
AAGCCGGGCGGTGAACTGCTGAATATGCATGCTGAGAAAGACATGAATATTTCGGTGGAGAATGATAAGA
CCGTTGCCATTGATGGATCCCGGACTACCACTATTGGAAAAGAGCAGAATGACGAAGTAACAGGTGATGC
GACTTTTCATTATAAACAGAAGCGGACTACTACGGTTGACCAACTTGAGTCGAATATATTCAATAATGGT
GAAAGTACAGAGATTAAAAACGGGCGAAAGCTAAATTTAAAAAGTGGAGGCGACGAGAGCAATATTACGG
GTGGACAAAAACTCAATCTTAACGGCACTAGGGAAGTCACTATATCAAACGGTGATATCCTTAATGTTCA
GGCTGAGGGGCGGAAGCAACATATAAATGGCAATGTTGAGGAGGAAATAAATGGCAATGTCGGAGTGAAT
ATAAATGGCAACTGGACTCAGACGGTTGAAGGCGGGACTGCATTTATCTCATCTCCAAATTTAATAAGAA
TTCAAAGTGCGACAAAGGTAGAAATTGATTCACCGCAAGGGCTTTATACTAATAAAGGTTTAAATGTCTC
TTTTAATGGAGCATCAATGTCATTTAACGGGATTAGTACTTCAGTAAATGGGACTAGTATAAGCTGGACT
CCAATAAATATGTCAACATCATTGACTAGCATTGTCCATTCACCCATGAATCATGTGCGTTCGTTGACAA
AGATAGAGTCTACCATGCAAAATGTCGCTATTGGTTTGCTTCACATGTTTATCTAA