SecReT6
Protein ID: 378766716
SecReT6 ID536
T6SS typei3
Gene symbolvgrG3
Locus tagPANA5342_1749
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1857334..1860045 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG9AQV1
KEGG IDplf:PANA5342_1749
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-73, Aligned region: 23..330
Phage_base_V [PF04717], Evalue: 4.10E-24, Aligned region: 368..461
Glucosaminidase [PF01832], Evalue: 3.00E-07, Aligned region: 760..878
Protein Sequence: 903 a.a.     [Download]
>gi|378766716|ref|YP_005195179.1| ImpA family type VI secretion-associated protein [Pantoea ananatis LMG 5342]
MFSRITVQLPAQGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPTDGLLSAVNPRYI
NGKITQIGVRSEELGGVRYAVYGLTVESDLWPMKRDRNLRIFQSQTVPQIVQTLLKEYGVNVETRLAGSY
RVWEYCVQYQESSFDFISRLMELEGMYYFFRHEADKHTLVLCDAPDQHQAFPGYETIAYHVTPSGGSVKE
EGVSQWALSESVTPGMYSTDDYDFRKPNAWMLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIRQE
VWQVEHHMVSGSGTATGIAPGYTFSLLNAPHFSDNGKYLVTSAHYDFEENSYASGDVGATRHNIDFTVLP
AAVTYRAKPETPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRSKDGTADTANALRFED
KAGEEHLWIQAQKNMDTHVKNDSSHSVANNHSHYAGGNELYRVETNRVHGVKGGEERLTGQGKIDNVVET
YVLGSGTKLRLECGESAIELNANGHINIVGKGFNLFVNGDGHITTSGGKLNLNTSGAQPGTGAPGAGHKG
NINQAVVNLFPPKQKGQAAPAAPKAAAAPAKATAAPLANSGDKKSKYNYTVDEMVKKQKGLKAKPVKWDN
ATKGFVPATEEDIKKYVDPANHMEGKDKYQFVDLSSSSGISKDEMSNFLKDKGTLAGQEQTYLDAAKKYN
VNEAYLAAHSALETGNGTSELAKGVMVNGTKVYNMYGIGALDGNAVQTGANYAYKQGWTTPAKAIDGGAK
WISDKFVGSGQNTLYKMRWNPASPGTHQYATDVNWATAQTTSMKKMFDSFPNANLSYDVPEYN
 
Nucleotide Sequence: 2712 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1857334-1860045 Pantoea ananatis LMG 5342, complete genome
ATGTTTTCACGTATTACAGTCCAGTTACCCGCACAAGGACTGCTGTTCCGACGTCTGAGCGGCAGCGAAG
CGCTGTCCCAGTCGTTCGTGCTGCAAGCGGAGCTGCTCTCCACCGACGCGCGCATTGATCGTAAGTCGTT
GCTGGGCAAGCCGGTCACGTTCACGCTGCCGACGGACGGTCTGCTGAGCGCGGTGAATCCGCGCTACATC
AACGGCAAAATTACGCAGATAGGCGTGCGCAGCGAGGAGCTGGGCGGCGTGCGCTACGCCGTTTACGGGC
TGACGGTGGAGTCGGATCTGTGGCCGATGAAGCGCGACCGCAACCTGCGCATCTTCCAGAGCCAGACGGT
GCCGCAGATTGTGCAGACGCTGCTGAAAGAGTACGGAGTGAACGTGGAAACGCGCCTGGCGGGAAGCTAC
CGGGTGTGGGAATACTGCGTGCAGTATCAGGAGAGCAGCTTCGACTTTATCAGCCGGCTGATGGAGCTGG
AGGGGATGTACTACTTCTTCCGGCACGAGGCGGACAAGCACACGCTGGTGCTGTGCGACGCGCCGGACCA
GCATCAGGCGTTCCCGGGCTACGAGACGATAGCCTACCACGTGACGCCGTCGGGCGGCAGCGTGAAGGAA
GAGGGCGTGAGCCAGTGGGCGCTGTCGGAAAGCGTGACGCCGGGGATGTACAGCACGGACGACTACGACT
TCCGCAAGCCGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGTGTCGCCGACCCCGGGCTCGGTGGA
TGTGTACGACTGGCCGGGGCGCTTCGTGGAGCACGGTCACGGCGAATACTACGCGCGTATCCGCCAGGAG
GTGTGGCAGGTGGAGCACCACATGGTGAGCGGGAGCGGCACGGCGACGGGCATCGCGCCGGGCTACACCT
TTTCGCTGCTCAACGCGCCGCACTTCAGCGACAACGGCAAATACCTGGTGACGTCGGCGCACTACGACTT
TGAAGAGAACAGCTACGCGAGCGGCGACGTGGGCGCCACGCGGCACAACATCGACTTCACGGTGCTGCCG
GCGGCGGTGACGTACCGTGCGAAGCCGGAGACGCCATGGCCGAAGACACACGGCCCGCAGACGGCGAAGG
TGGTGGGGCCGAAAGGCGAGAGCATCTGGACGGACAAATACGGCCGGGTGAAGGTGAAGTTCCACTGGGA
CCGTCTGGCGAAGGGTGACGACACCAGTTCGTGCTGGGTGCGCGTATCGAGCGCCTGGGCGGGTCAGGGC
TTCGGCGGGGTGCAGATCCCGCGCGTCAACGATGAGGTCGTCGTGGACTTCATCAACGGCGATCCAGACC
GTCCGTTGATCATTGGCCGCGTTTATAACGAAGCCAGTATGCCGCCATGGGCACTACCGGCTGCCGCCAC
ACAAATGGGCTTTCTGAGTCGCTCGAAAGACGGCACTGCGGATACCGCGAACGCATTACGCTTTGAGGAT
AAGGCGGGCGAGGAGCATTTGTGGATCCAGGCGCAGAAGAACATGGATACGCATGTTAAAAATGATTCCA
GCCATTCCGTTGCCAACAACCACAGCCACTATGCAGGCGGTAACGAACTCTATCGGGTTGAAACCAACCG
CGTGCATGGTGTTAAAGGTGGCGAAGAGCGTTTAACGGGACAAGGAAAAATCGACAACGTTGTCGAAACC
TACGTTCTTGGGTCAGGAACTAAGTTACGCCTTGAATGCGGCGAAAGTGCTATCGAACTCAATGCTAATG
GTCATATCAATATTGTCGGTAAGGGCTTCAATCTTTTTGTTAACGGTGATGGACACATCACTACATCAGG
CGGAAAACTCAATTTAAATACATCCGGTGCGCAGCCGGGTACGGGGGCACCTGGTGCTGGCCACAAAGGC
AACATCAATCAGGCCGTTGTGAATCTTTTCCCCCCAAAGCAAAAGGGGCAGGCGGCCCCGGCAGCACCTA
AAGCTGCGGCAGCACCTGCAAAAGCAACCGCTGCACCGTTAGCAAATTCTGGGGACAAGAAGAGTAAATA
TAACTACACGGTTGATGAGATGGTTAAAAAACAAAAGGGGCTGAAAGCAAAGCCAGTTAAATGGGATAAC
GCGACGAAAGGTTTTGTACCCGCAACAGAGGAAGATATTAAGAAATATGTCGATCCTGCTAACCATATGG
AAGGTAAAGACAAATATCAATTTGTTGATCTTTCTTCCTCATCTGGGATTAGTAAAGATGAGATGAGCAA
CTTTCTTAAAGATAAGGGCACGCTTGCTGGTCAGGAACAGACTTACCTGGATGCGGCAAAAAAATACAAT
GTCAATGAGGCTTACCTCGCAGCGCATTCCGCGCTGGAGACGGGAAATGGCACCAGTGAGTTGGCCAAAG
GCGTGATGGTCAATGGAACTAAAGTTTATAATATGTATGGCATTGGAGCGCTGGATGGAAATGCTGTACA
AACCGGTGCTAACTATGCCTACAAACAAGGGTGGACAACTCCGGCGAAGGCCATTGATGGCGGCGCAAAA
TGGATATCTGATAAGTTTGTTGGCTCTGGCCAGAATACTTTGTATAAAATGCGCTGGAATCCGGCCTCAC
CGGGAACGCACCAGTATGCCACAGATGTCAACTGGGCAACGGCTCAGACAACCAGCATGAAAAAAATGTT
CGACAGCTTTCCAAATGCGAATCTTTCTTATGACGTGCCTGAGTATAATTAA