SecReT6
Protein ID: 378953672
SecReT6 ID540
T6SS typei3
Gene symbolimpM
Locus tagPSF113_5791
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6671736..6672389 [-]
Productprotein ImpM
NoteTagF
UniProt IDG8Q709
KEGG IDpfe:PSF113_5791
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 3.20E-49, Aligned region: 5..142
Protein Sequence: 217 a.a.     [Download]
>gi|378953672|ref|YP_005211160.1| protein ImpM [Pseudomonas fluorescens F113]
MSTPGFYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQTNLGERWLDAYLVSPLWRFMVAPGVCGPD
AAVGVVMPSIDRVGRYFPLTVAMLLEPDADPASVVGGADEWFERVENLLLSTLSVEASFEAFNEQLETLG
SPMYLPRTPSSRFASLHRFDATDPQRRMSALAEAACEGASLWWGQGSERIAPGLMRCQGLPAAADFAQFL
LGQEGVV
 
Nucleotide Sequence: 654 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6672389-6671736 Pseudomonas fluorescens F113 chromosome, complete genome
ATGAGTACACCGGGCTTCTATGGAAAGTTGGCCAGCCGCGGCGATTTCGTCAGCCGTGGCTTGCCCCAGA
GTTTTATCGGCCCGTGGGATTCGTGGTTGGCGGCGGGTTTGCTCGCCAGCCAGACCAACCTTGGCGAGCG
CTGGCTGGATGCCTATCTGGTCAGCCCGCTGTGGCGCTTCATGGTCGCGCCGGGAGTGTGTGGCCCGGAC
GCCGCGGTCGGCGTGGTGATGCCGAGCATCGACCGGGTCGGTCGTTATTTTCCGCTGACCGTCGCGATGC
TGCTGGAGCCTGACGCGGACCCGGCGTCGGTGGTGGGCGGTGCGGACGAGTGGTTTGAGCGAGTCGAGAA
CCTGTTGCTGAGCACGTTGAGTGTGGAGGCCAGTTTCGAGGCGTTCAACGAACAGCTGGAGACCCTGGGC
AGCCCGATGTACCTGCCGCGCACGCCGAGCAGCCGCTTCGCCAGCCTGCATCGCTTCGATGCCACCGACC
CGCAGCGGCGCATGAGCGCCCTCGCCGAGGCGGCCTGCGAAGGCGCGAGCCTGTGGTGGGGCCAGGGATC
GGAACGCATTGCCCCGGGTTTGATGCGCTGCCAGGGATTGCCGGCGGCGGCTGATTTTGCGCAATTTTTG
CTCGGCCAAGAAGGTGTTGTGTAG