SecReT6
Protein ID: 378953674
SecReT6 ID540
T6SS typei3
Gene symbolimpK
Locus tagPSF113_5793
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6675883..6677193 [-]
Productprotein ImpK
NoteTssL
UniProt IDG8Q711
KEGG IDpfe:PSF113_5793
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-69, Aligned region: 53..258
OmpA [PF00691], Evalue: 1.10E-16, Aligned region: 326..424
Protein Sequence: 436 a.a.     [Download]
>gi|378953674|ref|YP_005211162.1| protein ImpK [Pseudomonas fluorescens F113]
MSNDDRTQFMPTPGGRGGDPFRPDAGRPQPTPAPAPLSMPAAPVLTGKAEGLNPLESAAGPLLALLTRLR
NTIAHPAPASLRAQLLAYLRQFEERAEAAGVVRNDVLLARYALCTALDEAVLSTPWGGTSDWGKQSLLIT
VHNEAWGGEKVFQLLEHCLQSPRERLYLLELLYLCMCLGFEGRYRVMNDGRSQLEVLRERTAAVIRSARG
DYERELSPHWRGVTVARDRLAQFMPPWIAVAIGAALLLALLFGLRMKLASDAEPVFKNIHFLGEIPVQTI
DRPVVQPKVIERPRLAGFLADEIRANRIAVEDAVDRSVVTIRGDELFASGSASIKDDFQPLMLRIADAVR
KVKGQVLVTGHSDNRPIATLRFPSNWALSEARAQSVLQILSAKTGQPERFSAEGRSDTEPLASNATTEGR
ARNRRVEITVLAEGVE
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6677193-6675883 Pseudomonas fluorescens F113 chromosome, complete genome
ATGAGTAACGACGATCGTACCCAGTTCATGCCGACGCCCGGTGGCCGTGGTGGAGATCCCTTCCGCCCGG
ACGCTGGCCGGCCACAGCCGACGCCTGCGCCTGCACCGCTGTCGATGCCGGCCGCGCCGGTGCTGACCGG
CAAGGCCGAGGGCCTCAACCCGCTGGAAAGCGCCGCCGGCCCACTGCTGGCCCTGCTGACGCGCCTGCGC
AACACCATTGCCCACCCGGCGCCGGCCAGTCTGCGCGCACAACTGCTGGCCTACCTGCGCCAGTTCGAAG
AGCGCGCCGAGGCCGCCGGCGTGGTGCGCAACGATGTATTGCTGGCCCGCTACGCCTTGTGCACCGCGCT
GGACGAAGCGGTGTTGAGCACCCCGTGGGGCGGCACCAGCGATTGGGGCAAGCAAAGCCTGTTGATCACC
GTGCACAACGAAGCCTGGGGCGGCGAGAAGGTGTTCCAGCTGCTGGAGCATTGCCTGCAAAGCCCGCGCG
AGCGCCTGTATCTGCTGGAGCTTTTGTACCTGTGCATGTGCCTGGGTTTCGAAGGGCGCTACCGGGTGAT
GAACGACGGTCGCAGCCAACTGGAAGTGTTGCGTGAGCGCACCGCCGCCGTCATCCGCAGTGCCCGTGGC
GATTACGAGCGCGAGCTGTCGCCGCACTGGCGCGGTGTCACTGTGGCCCGTGATCGACTGGCGCAATTCA
TGCCGCCGTGGATCGCCGTGGCCATCGGTGCAGCCCTGTTGCTGGCGCTGCTGTTCGGCCTGCGCATGAA
ACTGGCCTCCGATGCCGAGCCGGTGTTCAAGAACATTCATTTCCTTGGTGAAATCCCGGTGCAGACCATC
GACCGTCCTGTGGTGCAGCCCAAAGTGATCGAGCGCCCACGCCTGGCCGGCTTCCTCGCCGATGAAATCC
GCGCCAACCGCATTGCCGTGGAAGACGCCGTCGACCGCTCGGTGGTGACCATCCGCGGCGATGAACTGTT
CGCCTCGGGCAGCGCCAGCATCAAGGACGATTTCCAGCCGCTGATGCTGCGCATCGCCGATGCGGTGCGC
AAGGTCAAGGGCCAGGTCCTGGTCACCGGGCACAGCGACAATCGCCCGATCGCCACCCTCCGGTTCCCGT
CCAACTGGGCGTTGTCCGAAGCGCGGGCGCAATCGGTGCTGCAAATTCTCTCGGCCAAGACTGGCCAGCC
CGAGCGCTTCAGCGCCGAAGGCCGCAGCGACACCGAGCCGTTGGCATCCAACGCCACCACAGAGGGGCGT
GCGCGCAACCGTCGGGTTGAAATCACAGTATTGGCGGAGGGGGTCGAGTGA