SecReT6
Protein ID: 378953675
SecReT6 ID540
T6SS typei3
Gene symbolimpJ2
Locus tagPSF113_5794
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6677200..6678534 [-]
Productprotein ImpJ
NoteTssK
UniProt IDG8Q712
KEGG IDpfe:PSF113_5794
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.30E-155, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|378953675|ref|YP_005211163.1| protein ImpJ [Pseudomonas fluorescens F113]
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSAGAWGFSELLIDQGLLAQGKLAIISARGLLP
DGTPFNIPQDDLAPIPLNVDDNLRDGLVYLALPLKRAGARDTVDAGEDLGAARYVSQVCEVRDDNAPFEN
RAPVALGSRALRLLTEQDGIGDYAAIGVVRIKEKRADRALVLDDAYIPPLLDVIASKPLAAFRSELLGLL
HQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLIQHLSQLSPLHPERFYSELVSLAGEFSTFTASG
RRPQQYPPYQHDDLALSYAPVMQALREALSMLIDSKATPIPIVEKAYGIHVAMLADKTLLDSASFILVVR
ADVPAETLRGRFGQQSKVGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSDHWQQLSN
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6678534-6677200 Pseudomonas fluorescens F113 chromosome, complete genome
ATGTCCTGGAACAATCGCGTGGTCTGGTCGGAAGGCATGTTCATTGGAACGCAGCACTTCCAACAGCATG
ACCGTTACCTGGAAAACCTCATCGACGCACGCAGCCGCCCGTTGTCGGCCGGCGCCTGGGGTTTTTCCGA
ATTGCTGATCGACCAGGGCCTGCTGGCCCAGGGCAAGCTGGCAATCATCTCGGCGCGCGGTCTGCTGCCG
GACGGTACGCCCTTCAACATTCCCCAGGATGACCTGGCGCCGATCCCATTGAACGTCGACGACAACCTGC
GCGACGGCCTGGTGTACCTGGCCTTGCCGCTCAAGCGCGCCGGCGCCCGGGACACCGTGGACGCAGGCGA
AGACCTCGGCGCTGCGCGTTATGTGAGCCAGGTGTGCGAAGTGCGCGACGACAACGCACCGTTCGAAAAC
CGCGCACCGGTGGCCCTCGGCTCGCGGGCGCTGCGGTTGTTGACCGAACAGGATGGCATCGGCGACTACG
CCGCCATCGGCGTGGTGCGCATCAAGGAAAAACGCGCCGACCGTGCATTGGTGCTCGACGACGCCTACAT
CCCGCCGCTGCTGGATGTGATCGCCTCCAAACCGCTGGCGGCGTTCCGCAGTGAACTGCTGGGCCTGCTG
CATCAACGCGGCGAAGCCCTGGCCGGGCGGGTGGTGGCGTCCGGCGCCGGTGGCGCCTCGGAAATTGCCG
ATTTCATGCTGTTGCAACTGGTCAACCGCGCCCAGCCGCTGATCCAGCACCTGAGCCAGTTGAGCCCGCT
GCATCCCGAGCGTTTCTACAGCGAGCTGGTGAGCCTGGCCGGGGAGTTCTCCACGTTCACCGCCTCCGGG
CGACGACCGCAACAATATCCGCCTTACCAGCACGATGACCTGGCGCTCAGCTACGCGCCCGTGATGCAGG
CCCTTCGCGAAGCCCTGTCGATGCTGATCGACAGCAAGGCGACGCCAATTCCGATTGTCGAGAAAGCCTA
CGGCATCCACGTGGCGATGCTGGCCGACAAGACCCTGCTCGACAGTGCCAGTTTCATCCTGGTGGTGCGC
GCCGACGTGCCGGCCGAGACCCTGCGCGGCCGCTTCGGCCAGCAGAGCAAGGTCGGTTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAACTGCCGGGCATCGGCCTGCTGCCGTTGCCAGTGGCACCGCGGCAGCT
GCCGTACCACGCCGGCTCCACTTACTACGAACTCGACCGGGGCAGCGATCACTGGCAACAGTTGAGCAAC
TCCGGCGGGTTTGCGTTCCACATCGCCGGCCAGTTCCCAGGGCTGAACCTGGCCTTCTGGGCGATCCGAG
GATAA