SecReT6
Protein ID: 378953677
SecReT6 ID540
T6SS typei3
Gene symbolimpI
Locus tagPSF113_5796
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6679125..6680555 [-]
Productprotein ImpI
NoteFha
UniProt IDG8Q714
KEGG IDpfe:PSF113_5796
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.60E-17, Aligned region: 3..70
Protein Sequence: 476 a.a.     [Download]
>gi|378953677|ref|YP_005211165.1| protein ImpI [Pseudomonas fluorescens F113]
MAIGRNSDNDWVLPDPERLVSGKHCVIQYKDGRYYLTDNSTNGVELVKAGVRLRKGNSEPLQDGEVIRIG
DYEIQARVDFSLPVTDSNPFAESPSSFEALMGRQGAAVHTPSPIQVTSPAHFQGGSAMDTLPDLFDFLSP
SSVPPATQPDHVPAEQHDFRPPTPIPRPSPPPVVEPVMPPSASVIPDDWDPFSDKPAPVAVAPLPVAPPP
VPLPPVLEPVATPAPQAPLPDIFAEIIAPPPPVPEASVTRVEPPVAPPVAPVAPVAPVAPVVPVVPVEAN
QPDLLQAFLRGAGLDQLRLDKANAEAQMESIGRSYRLMVEGLIDVLRARSSLKGEFRIQQTMIQPVENNP
LKFAPNVDEALLLLLRHGNQAFMAPDAAVRDSFDDLRAHQLAVMAGVEAAIKHLLGRFEPAQLEERMAKP
GGLSGIFSGSRQAQYWQQFTELYSNISREAQEDFQDLFGREFSRAYEEHSTRQRRR
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6680555-6679125 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGCAATTGGCCGTAATTCCGATAATGACTGGGTATTGCCGGACCCTGAGCGTCTGGTTTCCGGCAAAC
ATTGCGTTATCCAATACAAAGATGGGCGTTATTACTTAACCGATAACAGCACTAATGGTGTGGAATTGGT
CAAGGCCGGTGTTCGCCTGCGCAAGGGCAACAGCGAACCCCTGCAAGATGGCGAAGTGATCCGCATCGGT
GATTATGAAATCCAGGCGCGCGTCGATTTCAGCCTGCCGGTCACCGACAGCAACCCGTTTGCCGAATCGC
CCAGCAGTTTCGAGGCCTTGATGGGGCGCCAGGGCGCAGCGGTGCATACACCGTCGCCGATCCAAGTGAC
GTCGCCTGCGCATTTCCAGGGTGGGTCGGCCATGGACACCTTGCCGGATCTGTTCGATTTCTTGAGTCCG
AGCAGTGTCCCGCCCGCCACCCAGCCCGACCATGTGCCGGCCGAGCAACACGATTTCCGCCCGCCGACAC
CGATTCCCCGGCCGAGCCCGCCGCCCGTGGTGGAGCCGGTGATGCCGCCGTCTGCCTCGGTGATTCCGGA
TGACTGGGACCCGTTCAGCGACAAGCCCGCGCCAGTGGCGGTTGCCCCGCTGCCCGTGGCTCCGCCGCCT
GTGCCGCTACCGCCGGTGCTTGAGCCGGTCGCGACGCCTGCCCCGCAGGCTCCGCTCCCCGACATCTTTG
CTGAAATCATTGCACCGCCGCCGCCCGTGCCTGAAGCGTCGGTCACTCGCGTCGAGCCCCCGGTCGCACC
TCCAGTTGCTCCAGTTGCTCCAGTTGCTCCAGTTGCTCCGGTTGTTCCAGTCGTCCCGGTCGAGGCCAAC
CAACCCGACTTGCTGCAAGCGTTCCTGCGCGGTGCCGGGCTCGACCAGTTGCGCCTGGACAAGGCCAACG
CCGAAGCTCAGATGGAAAGCATCGGGCGCAGCTATCGGTTGATGGTCGAAGGCCTGATCGATGTCTTGCG
CGCCCGCAGCAGCCTCAAGGGTGAGTTCCGTATCCAGCAGACGATGATCCAGCCGGTGGAAAACAACCCG
CTGAAATTCGCCCCCAATGTCGATGAAGCCCTGCTGTTGCTGTTGCGCCACGGCAACCAGGCGTTCATGG
CCCCGGACGCGGCGGTGCGTGACAGTTTCGATGACTTGCGGGCCCACCAACTGGCGGTGATGGCCGGTGT
GGAAGCGGCCATCAAGCATTTGCTGGGGCGCTTCGAGCCGGCGCAACTGGAAGAACGCATGGCCAAGCCC
GGTGGGCTCTCGGGTATTTTCAGCGGCTCGCGACAGGCCCAGTACTGGCAGCAGTTCACCGAGCTCTACA
GCAACATTTCCCGGGAGGCCCAAGAGGATTTCCAGGACCTGTTCGGTCGCGAGTTCAGCCGCGCCTACGA
AGAACACAGTACGCGACAGCGACGCCGCTAA