SecReT6
Protein ID: 378953678
SecReT6 ID540
T6SS typei3
Gene symbolimpA2
Locus tagPSF113_5797
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6681052..6682089 [+]
Productprotein ImpA
NoteTssA
UniProt IDG8Q715
KEGG IDpfe:PSF113_5797
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 53..112
Protein Sequence: 345 a.a.     [Download]
>gi|378953678|ref|YP_005211166.1| protein ImpA [Pseudomonas fluorescens F113]
MDVPLLLAAVSATSPCGEDLEYDADFLRLERDSRGQPERSMGDSILPAEPPEWRSIQQQSLDLLQRSKDL
RITHFLLQSSLALEGLPGMARVLTLISELLKQYWAELHPRLDADDDNDPTVRINALAGLTSDITIRLLRE
SILARSRTFGAVSLRAAANASGLQSFPDENLGAEQLAGALLDSDPEQLEITRAALLEARSAAEAIEQQVS
DQVGSAQGVDLGPLKQPLKMALQILGQFAPQSGDSALSDPVSDDSAAPTEYASAPSTPRNTSTSTVSGEI
NNRDDVLRSLDRILAYYTRHEPSSPLPVLLNRAKNLVHADFAAIVRNLIPDGMSQFENLRGPDSE
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6681052-6682089 Pseudomonas fluorescens F113 chromosome, complete genome
GTGGATGTGCCTTTGTTGCTCGCCGCCGTTTCCGCGACTTCGCCGTGTGGTGAAGATCTGGAATATGACG
CGGATTTCTTGCGCCTGGAACGCGACTCCCGGGGTCAGCCCGAACGTAGCATGGGCGATTCGATCCTGCC
TGCCGAGCCTCCTGAATGGCGCAGCATCCAGCAGCAGAGCCTGGACTTGCTGCAACGCAGCAAAGACCTG
CGCATCACCCATTTCCTGTTGCAAAGCTCCCTGGCCCTCGAAGGCCTGCCGGGCATGGCCCGTGTGCTGA
CGCTGATCAGCGAACTGCTCAAGCAATACTGGGCCGAGCTGCATCCGCGCCTGGACGCCGATGACGACAA
CGACCCCACCGTACGTATCAATGCCCTCGCCGGCCTGACGTCCGATATCACCATTCGCCTGCTGCGCGAG
AGCATCCTGGCCCGTTCGCGGACCTTCGGTGCCGTCAGCCTGCGCGCCGCCGCCAACGCCAGCGGCCTGC
AAAGTTTCCCGGATGAAAACCTCGGCGCCGAACAGCTCGCCGGGGCCCTGCTCGACAGCGACCCCGAGCA
GTTGGAAATCACCCGCGCCGCCCTGCTCGAAGCCCGCAGCGCCGCCGAAGCCATCGAACAACAGGTCAGT
GACCAGGTCGGTTCCGCCCAGGGCGTGGACCTTGGCCCGCTGAAGCAACCGCTGAAGATGGCCCTGCAGA
TTCTCGGCCAGTTCGCCCCGCAGAGCGGCGACAGCGCCCTGTCCGATCCCGTCAGCGACGACAGCGCCGC
GCCAACGGAATATGCCAGCGCGCCAAGCACGCCGCGCAACACCAGCACGAGCACCGTCAGCGGCGAAATC
AACAACCGCGACGACGTGCTGCGCAGCCTGGACCGGATTCTCGCTTACTACACCCGTCATGAGCCCTCCA
GCCCGCTGCCGGTGCTGTTGAACCGGGCCAAGAATCTGGTGCACGCCGACTTCGCGGCCATCGTGCGCAA
CCTGATTCCCGACGGCATGAGTCAATTTGAAAACCTGCGCGGCCCAGACAGCGAATAA