SecReT6
Protein ID: 378953679
SecReT6 ID540
T6SS typei3
Gene symbolimpB2
Locus tagPSF113_5798
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6682171..6682677 [+]
Productprotein ImpB
NoteTssB
UniProt IDG8Q716
KEGG IDpfe:PSF113_5798
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.70E-60, Aligned region: 10..163
Protein Sequence: 168 a.a.     [Download]
>gi|378953679|ref|YP_005211167.1| protein ImpB [Pseudomonas fluorescens F113]
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPLAAVADRKFLEIDVDNFD
SRLKAMQPRVAFHVPNELTGEGNLSLDLTFESMDDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTG
AEEIIMKAIKDPALLQALASAPKPAQDQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6682171-6682677 Pseudomonas fluorescens F113 chromosome, complete genome
GTGGCGAAGCAAAGTTCTCAGAAATTCATCGCGCGCAACCGCGCGCCTCGAGTGCAGATCGAGTACGACG
TCGAGCTCTACGGCGCCGAGAAAAAGGTCCAGTTGCCCTTCGTCATGGGCGTGATGGCCGACCTCGCCGG
CAAGCCCGCCGAGCCTCTGGCAGCGGTGGCTGATCGCAAGTTCCTCGAGATCGACGTCGACAACTTCGAC
TCGCGCCTCAAGGCCATGCAGCCGCGCGTGGCGTTCCATGTGCCTAACGAATTGACCGGCGAAGGCAATC
TGAGCCTGGACCTGACGTTCGAAAGCATGGACGACTTCAGCCCGGCGGCCGTGGCCCGCAAGGTCGACTC
GCTGAACAAACTGCTCGAAGCGCGCACCCAGTTGGCCAACCTGCTGACCTACATGGACGGCAAGACCGGC
GCCGAAGAAATCATCATGAAGGCGATCAAGGACCCAGCGCTGTTGCAGGCCCTGGCGAGCGCGCCGAAGC
CAGCACAGGACCAATGA