SecReT6
Protein ID: 378953680
SecReT6 ID540
T6SS typei3
Gene symbolimpC2
Locus tagPSF113_5799
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6682674..6684176 [+]
Productprotein ImpC
NoteTssC
UniProt IDG8Q717
KEGG IDpfe:PSF113_5799
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.60E-196, Aligned region: 69..495
BMFP [PF04380], Evalue: 0.0011, Aligned region: 23..82
Protein Sequence: 500 a.a.     [Download]
>gi|378953680|ref|YP_005211168.1| protein ImpC [Pseudomonas fluorescens F113]
MIMTDNTAREGVQNLGATQETSEFASLLLQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIE
SIIAAIDAKLTAQVNQVIHHPDFQQLESAWRGLHYLVNNTESDEQLKIRVLNVSKTDLHKTLKKFKGTAW
DQSPIFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQ
ELSNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYT
WANAAYAMAVNINRSFKHFGWCSRIRGVESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKN
GFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEK
DEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVIVEEVEGNPGYYNSKFYLRPHYQLEGLTVSLRL
VSKLPSAKGA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6682674-6684176 Pseudomonas fluorescens F113 chromosome, complete genome
ATGATCATGACTGACAATACCGCTCGCGAAGGCGTGCAAAACCTGGGTGCTACCCAAGAAACCAGCGAGT
TCGCGTCCCTGCTGCTGCAAGAATTCAAACCCAAGACCGAGCGCGCCCGCGAAGCCGTCGAAACGGCCGT
ACGCACCCTGGCCGAACAGGCCCTGGCGCAGACCGACCTGGTGTCCAACGACGCCATCAAGTCGATCGAA
TCGATCATCGCCGCCATCGACGCCAAGCTCACCGCCCAGGTCAACCAGGTCATCCACCACCCTGACTTCC
AGCAACTGGAAAGCGCCTGGCGTGGCCTGCACTATCTGGTCAACAACACCGAGTCCGATGAGCAGCTCAA
GATCCGTGTGCTCAACGTCTCCAAGACCGACCTGCACAAGACCCTGAAGAAATTCAAGGGCACCGCGTGG
GACCAGAGCCCGATCTTCAAGAAGATGTACGAAGAAGAATACGGCCAGTTCGGCGGCGAGCCTTACGGCT
GCCTGGTTGGCGACTACTACTTCGACCAGTCGCCACCGGATGTCGAGCTGCTGGGCGAACTGTCGAAAGT
CTGCGCGGCCATGCACTCCCCGTTCATCGCTGCGGCATCGCCGACCGTGATGGGCATGGGCTCGTGGCAG
GAACTGTCGAACCCGCGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGTTCGTTGC
GTGAATCGGAAGACTCGCGCTACATCGGCCTGACCATGCCACGCTTCCTGGCGCGCCTGCCGTACGGCGC
CAAGACCGACCCGGTGGAAGCCTTCGCCTTCGAAGAAAACACCGACGGCGCCGACAGCTCCAAGTACACC
TGGGCCAACGCCGCTTACGCGATGGCGGTGAACATCAACCGTTCGTTCAAACACTTCGGTTGGTGCTCGC
GCATCCGTGGCGTGGAGTCCGGCGGTGAAGTGGAAAACCTGCCAGCCCACACCTTCCCGACCGACGACGG
TGGCGTGGACATGAAGTGCCCGACCGAAATCGCCATCTCGGACCGCCGTGAAGCGGAACTGGCGAAGAAC
GGTTTCATGCCGCTGCTGCACAAGAAAAACACCGACTTCGCCGCGTTCATCGGCGCCCAGTCGTTGCAGA
AACCGGCCGAATACGACGACCCGGACGCCACCGCCAACGCCAACCTGGCCGCGCGCCTGCCGTACCTGTT
CGCCACTTGCCGTTTCGCCCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCCTTCAAAGAGAAG
GACGAGATGCAGCGCTGGTTGCAGGACTGGATCCTCAACTACGTCGACGGTGACCCGGCGCACTCCACCG
AGACCACCAAGGCCCAGCACCCGTTGGCTGCAGCCGAAGTGATCGTCGAAGAAGTCGAAGGCAACCCGGG
GTACTACAACTCCAAGTTCTACCTGCGCCCGCACTACCAGCTCGAAGGGCTGACCGTGTCGCTGCGCCTG
GTATCGAAACTGCCGTCGGCCAAGGGCGCGTAA