SecReT6
Protein ID: 378953684
SecReT6 ID540
T6SS typei3
Gene symbolimpF2
Locus tagPSF113_5803
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6685849..6686361 [+]
Productprotein ImpF
NoteTssE
UniProt IDG8Q721
KEGG IDpfe:PSF113_5803
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-23, Aligned region: 37..145
Protein Sequence: 170 a.a.     [Download]
>gi|378953684|ref|YP_005211172.1| protein ImpF [Pseudomonas fluorescens F113]
MVTEIATRDRLQPSLLDRLTDDDPTNPKESADKRVLSLTQLKASVLRDLAWLLNTTSLLSADATLHTPAG
TSVVNFGLPALAGNSASNVDVSALETLIHQAIATFEPRILRHTLRVRARATAEMNHNALSFEIEGDLWAQ
PVPLRLMLQTDLDLETGHVRVVNADQRRRS
 
Nucleotide Sequence: 513 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6685849-6686361 Pseudomonas fluorescens F113 chromosome, complete genome
GTGGTAACCGAAATCGCCACCCGCGATCGCCTGCAACCGTCCCTGCTGGACCGGTTGACCGACGACGATC
CGACCAACCCCAAGGAAAGCGCCGACAAGCGCGTGCTCTCCCTGACCCAATTGAAAGCCTCGGTGCTGCG
TGACCTGGCGTGGCTGCTCAACACCACGTCATTGCTCAGCGCCGATGCCACGCTGCATACCCCGGCGGGC
ACGTCGGTGGTGAATTTCGGCCTGCCGGCACTGGCCGGCAACAGCGCGTCGAACGTCGATGTCTCGGCCC
TGGAAACCTTGATCCACCAGGCCATTGCCACCTTCGAACCGCGGATCCTGCGTCACACCCTGCGGGTGCG
GGCCCGGGCCACGGCCGAGATGAACCACAACGCGTTGAGTTTCGAGATCGAAGGCGATCTCTGGGCCCAG
CCGGTGCCGCTGCGCCTGATGCTGCAAACCGACCTGGACCTGGAAACCGGCCATGTGCGCGTGGTCAACG
CCGACCAGCGGAGACGCTCATGA