SecReT6
Protein ID: 378953685
SecReT6 ID540
T6SS typei3
Gene symbolimpG2
Locus tagPSF113_5804
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6686358..6688217 [+]
Productprotein ImpG
NoteTssF
UniProt IDG8Q722
KEGG IDpfe:PSF113_5804
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-219, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|378953685|ref|YP_005211173.1| protein ImpG [Pseudomonas fluorescens F113]
MNPRLLELYNQELHHVRESAAEFAKEYPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLQADPDEGSLSSGFPLPRDTVLRAALGRETQTCCEYRTAHAVTLWP
LQVSQAEYFGNPSAVLGRLAASEPKAKAGLRITLRTGAELPFNSLALDNLPLYLSGADEQPFRLYEQLLG
NTCAVFARKPGGDWVERLPQDALRSRGFDDADAALPVVPRAFQGYRLLQEYFALPHRFLFVDFTQLSRAV
KRCDGQELELIVLFDRHDPSLEGSVGASQFLPFCTPAINLFPKRLDRIHLSDRVNEHHVIADRTRPMDFE
VHSLNGLTGHGTGPEQPFLPFYAVRDPSRYGRDQAYYTVRREPRVLSSDQRRNGPRSTYIGSETFVSLVD
SQQAPYRHDLRQLGVTALCTNRDLPLFMSVGNGKTDFTLADSAPVGAVRCVAGPSRPRASHAHDAKAWRL
ISQLSLNYLSLSEQGQGAAALRELLRLYGDSNDAALQLQIEGLREVSSKACTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6686358-6688217 Pseudomonas fluorescens F113 chromosome, complete genome
ATGAACCCACGCCTGCTGGAGCTGTACAACCAGGAACTGCACCACGTGCGCGAAAGCGCGGCGGAGTTCG
CCAAGGAATACCCGAAGATCGCCAGTCGGCTGACGTTGTCCGGCATGGACTGCGCCGACCCGTATGTCGA
GCGCCTGCTGGAAGGCTTCGCCTACCTGACGGCGCGGGTGCAGCTCAAGCTCGACGCCGAGTACCCGACC
TTCACCCACAACCTGCTGGAAATCGCCTACCCGCATTACCTGGCGCCGACGCCGTCGATGACCGTGGTGC
AATTGCAGGCCGACCCGGACGAAGGCTCGCTGAGCAGTGGTTTCCCGCTGCCGCGCGATACGGTCCTGCG
TGCCGCCCTGGGGCGTGAAACCCAGACCTGCTGCGAGTACCGCACCGCCCACGCGGTGACGTTGTGGCCG
TTGCAGGTCAGCCAGGCCGAATACTTCGGCAACCCGTCCGCCGTGCTCGGGCGCCTGGCCGCCAGCGAAC
CGAAAGCCAAGGCCGGCCTGCGCATCACACTGCGCACCGGCGCCGAGCTGCCGTTCAACAGCCTGGCCCT
GGACAACCTGCCGCTGTACTTGAGCGGTGCCGACGAACAGCCTTTCCGCCTCTACGAACAACTGCTGGGC
AATACCTGCGCAGTGTTCGCCCGCAAGCCCGGCGGCGACTGGGTGGAGCGGCTGCCCCAGGATGCGTTGC
GCTCGCGCGGCTTCGACGATGCCGACGCCGCGCTGCCGGTGGTGCCGCGGGCCTTCCAGGGCTATCGCCT
GTTGCAGGAATACTTCGCCCTGCCCCACCGTTTCCTGTTTGTCGACTTCACCCAGTTGAGCCGCGCGGTC
AAGCGTTGCGACGGCCAGGAGCTGGAGCTGATCGTGCTGTTCGACCGTCACGACCCAAGCCTGGAAGGCA
GCGTCGGCGCTTCGCAGTTCCTGCCGTTCTGCACCCCGGCCATCAACCTGTTTCCCAAGCGCCTGGACCG
CATTCACTTGTCGGATCGGGTCAACGAACACCACGTGATCGCCGACCGTACCCGGCCGATGGATTTCGAA
GTGCATTCGCTGAACGGCCTCACCGGCCACGGCACCGGGCCGGAGCAGCCGTTCCTGCCGTTCTACGCCG
TGCGCGATCCGTCCCGTTACGGCCGCGACCAGGCCTATTACACCGTGCGCCGCGAACCGCGCGTGCTGTC
CAGCGATCAACGACGCAACGGCCCGCGCTCGACCTACATCGGCAGCGAAACCTTCGTCAGCCTGGTGGAC
AGCCAGCAAGCGCCCTATCGCCACGACCTGCGCCAACTGGGCGTGACCGCGTTGTGCACCAACCGCGACC
TGCCGCTGTTCATGAGCGTGGGCAACGGCAAGACCGACTTCACCCTCGCCGACAGTGCTCCGGTGGGCGC
CGTGCGCTGCGTGGCAGGTCCGAGTCGCCCACGGGCCAGCCACGCCCACGACGCCAAGGCCTGGCGGCTG
ATCAGCCAGTTGTCACTGAACTACTTGTCGTTGAGCGAACAAGGCCAAGGCGCGGCCGCCCTGCGTGAAC
TGCTGCGCCTGTACGGCGACAGCAACGACGCGGCGCTGCAATTGCAGATCGAAGGCCTGCGCGAAGTCAG
CAGCAAGGCCTGCACCCGGCGCCTGCCGATGCCCGGCCCGATCGTGTTTGGTCGAGGCCTGGAAATCACC
CTGGAATTCGATGAAAACGCGTTTCGCGGCACCGGGGTGTTCCTGCTCGGCGCGGTGTTCGAGCGCTTCC
TGGCACGCTATGTGTCGATCAACAGTTTTACCGAGACGGTGATCCGTACCACCGAACGCGGCGAGATCAT
GCGATGGAAAGCCAAGCCCGGACGTCGTCCGACCCTGTGA