SecReT6
Protein ID: 378953686
SecReT6 ID540
T6SS typei3
Gene symbolimpH2
Locus tagPSF113_5805
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6688232..6689230 [+]
Productprotein ImpH
NoteTssG
UniProt IDG8Q723
KEGG IDpfe:PSF113_5805
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-109, Aligned region: 3..302
Protein Sequence: 332 a.a.     [Download]
>gi|378953686|ref|YP_005211174.1| protein ImpH [Pseudomonas fluorescens F113]
MHQEPWEYDFFQALRRIECESPELPRLGHSLRLADDPLRLGQRAECTFAPATLASVQPGSDGAPARLEQF
FFGLGGPNGPMPLHITEYVRERQRNNADSTSKRFLDVFHHRLLSLFYRAWAEARPTVSHDRPDDDYWSAR
LAALSGRGMPSLLNQGLIPDTAKLHYSGHLAAQTRYPDGLKAILGEYFGLPVEIEEYVGQWLELPERSRI
GVNAQLGVDFCLGRFVWDRQHKFRIRLGPLKLVDYMGMLPGSQPFNELVAWVAEYLGHELDWDLNLVLEQ
PEVPALQLNGRFRLGFNTWLGRPETDANDLILARHYAEQANTSQTSRSHEHG
 
Nucleotide Sequence: 999 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6688232-6689230 Pseudomonas fluorescens F113 chromosome, complete genome
ATGCACCAGGAGCCCTGGGAATATGACTTCTTCCAGGCGCTGCGACGCATCGAGTGCGAATCCCCCGAGC
TGCCGCGCCTGGGCCATTCCCTGCGCCTGGCCGACGACCCGCTGCGCCTCGGGCAACGGGCCGAATGCAC
CTTCGCCCCGGCCACCCTTGCCTCGGTGCAACCGGGCAGCGATGGCGCGCCGGCACGCCTGGAGCAATTT
TTCTTCGGTCTCGGCGGCCCCAACGGCCCGATGCCGCTGCACATCACCGAATACGTGCGCGAACGCCAGC
GCAACAACGCCGACAGCACCAGCAAGCGCTTCCTCGATGTGTTCCATCATCGCCTGCTCAGCCTGTTTTA
TCGGGCCTGGGCCGAAGCGCGGCCGACGGTCAGCCATGATCGCCCGGACGATGACTATTGGTCGGCGCGC
CTGGCCGCCCTCAGCGGTCGGGGGATGCCGAGCCTGCTCAACCAGGGGTTGATCCCCGACACGGCGAAGC
TGCACTACAGCGGCCACCTGGCGGCGCAAACCCGCTACCCGGACGGTTTGAAGGCAATCCTCGGCGAGTA
CTTCGGCCTGCCGGTGGAGATCGAAGAATACGTCGGCCAATGGCTGGAACTGCCTGAACGCAGCCGAATC
GGTGTCAACGCCCAACTGGGCGTGGACTTCTGCCTGGGCCGCTTCGTGTGGGATCGCCAGCACAAATTCC
GCATTCGCCTGGGGCCACTCAAGCTCGTTGACTACATGGGCATGCTGCCCGGCAGCCAACCGTTCAACGA
GCTGGTGGCCTGGGTCGCCGAATACTTGGGCCATGAACTGGACTGGGACCTGAACCTGGTCCTGGAGCAA
CCCGAAGTCCCGGCACTGCAACTCAATGGGCGTTTCCGCCTGGGTTTCAACACCTGGCTGGGCCGTCCCG
AAACAGATGCCAACGATTTAATACTGGCCCGGCATTACGCCGAACAGGCCAACACCTCACAGACCTCAAG
GAGCCATGAGCATGGGTGA