SecReT6
Protein ID: 378953687
SecReT6 ID540
T6SS typei3
Gene symbolclpB3
Locus tagPSF113_5806
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6689223..6691913 [+]
Productchaperone ClpB
NoteTssH
UniProt IDG8Q724
KEGG IDpfe:PSF113_5806
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.10E-39, Aligned region: 625..791
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 234..368
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 631..715
ClpB_D2-small [PF10431], Evalue: 9.50E-16, Aligned region: 798..872
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 351..364
AAA_5 [PF07728], Evalue: 1.10E-12, Aligned region: 630..756
AAA_16 [PF13191], Evalue: 5.50E-12, Aligned region: 43..78
AAA_16 [PF13191], Evalue: 5.50E-12, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 5.50E-12, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 5.50E-12, Aligned region: 481..545
AAA_16 [PF13191], Evalue: 5.50E-12, Aligned region: 600..675
AAA_16 [PF13191], Evalue: 5.50E-12, Aligned region: 789..845
Sigma54_activat [PF00158], Evalue: 8.10E-07, Aligned region: 213..247
Sigma54_activat [PF00158], Evalue: 8.10E-07, Aligned region: 629..749
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 358..400
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 628..651
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 692..712
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 499..556
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 628..655
Zeta_toxin [PF06414], Evalue: 3.90E-05, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 3.90E-05, Aligned region: 624..670
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 285..318
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 630..651
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 701..712
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 17..46
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 628..652
NACHT [PF05729], Evalue: 0.0003, Aligned region: 234..334
NACHT [PF05729], Evalue: 0.0003, Aligned region: 631..657
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 234..251
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 632..659
AAA_18 [PF13238], Evalue: 0.00041, Aligned region: 819..861
IstB_IS21 [PF01695], Evalue: 0.00042, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.00042, Aligned region: 630..658
AAA_17 [PF13207], Evalue: 0.00092, Aligned region: 234..251
AAA_17 [PF13207], Evalue: 0.00092, Aligned region: 630..666
AAA_17 [PF13207], Evalue: 0.00092, Aligned region: 817..839
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0018, Aligned region: 628..655
Torsin [PF06309], Evalue: 0.0021, Aligned region: 588..654
Clp_N [PF02861], Evalue: 0.0037, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.0037, Aligned region: 108..142
Protein Sequence: 896 a.a.     [Download]
>gi|378953687|ref|YP_005211175.1| chaperone ClpB [Pseudomonas fluorescens F113]
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLQDSDLHRIIRQFNIEPARLARD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVLGILKTPSLRHALLGLSSEFDK
VKVEALSERFDEYVGDSPENALTASDGFNAGAVPGEASGAMAPSAMGKQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGA
SMKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVAEPSEDKALLMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREHAIGVVIGSRQTQSETLLSAERERLAE
LEGRWAEEKTLVDELLATRATLRERVGVVDSEDNSEASDNESHQLREKLVDLQQRLTALQGETPLILPTV
DYQAVASVVADWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMIAKRIQTSRAGLDNPSKPIGVF
MLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPY
SVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTTNAGTELIAQVCKDPQNVPEPEEI
AKALRQPLLEIFPPALLGRLVTIPYYPLSDEMLKAITRLQLNRIKKRVESTHKVAFDYDDAVIDLIVSRC
TETESGGRMIDTILTNSLLPDMSREFLTRMLEGKALAGVRISAVDNELQYDFSDAA
 
Nucleotide Sequence: 2691 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6689223-6691913 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGGTGAAATCAGTCGCGCCGCGTTGTTCGGCAAACTCAACAGCGTGGCCTACAAAGCCATTGAAGCCG
CCACCGTGTTCTGCAAATTGCGCGGTAACCCTTATGTGGAACTGGCCCACTGGTTTCACCAGTTGCTGCA
ACTGCAGGACTCGGACCTGCACCGCATCATTCGCCAGTTCAACATCGAGCCGGCGCGCCTGGCCCGCGAC
CTGACCGAAGCCCTGGACCGCCTGCCACGGGGTTCGACGTCGATCACCGACCTGTCGTCCCACGTGGAAG
AAGCCGTGGAACGCGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAAAGCCAGGTGCGCACCGGTTACCT
GGTGCTGGGCATTCTCAAGACCCCGAGCCTGCGCCACGCGCTGCTGGGCCTGTCGTCGGAGTTCGACAAG
GTCAAGGTCGAAGCCCTGAGCGAACGGTTTGACGAATACGTCGGCGACTCGCCGGAAAACGCCCTGACTG
CCAGCGACGGCTTCAATGCCGGTGCCGTGCCGGGCGAAGCCAGCGGCGCCATGGCCCCTAGCGCCATGGG
CAAACAGGAAGCCCTCAAGCGCTTTACCGTCGACCTTACCGAGCAGGCCCGCAGCGGCAAGCTCGACCCA
ATCGTCGGCCGTGACGAAGAGATCCGCCAACTGGTGGACATCCTCATGCGCCGCCGGCAGAACAACCCGA
TCCTTACCGGTGAAGCCGGCGTGGGCAAGACCGCCGTGGTCGAAGGCTTCGCCCTGCGCATCGTCGCCGG
CGACGTACCACCGGCCCTCAAGGACGTGGAACTGCGCAGCCTCGACGTTGGCCTGTTGCAGGCCGGCGCG
AGCATGAAAGGCGAGTTCGAACAGCGCCTGCGCCAGGTCATCGAAGACGTCCAGGCCTCGCCCAAGCCGA
TCATCCTGTTCATCGACGAAGCCCACACCCTGGTGGGTGCCGGCGGCGCCGCCGGCACGGGCGACGCGGC
CAACCTGCTCAAGCCGGCGTTGGCCCGCGGCACCTTGCGCACCGTGGCCGCCACGACCTGGGCCGAGTAC
AAGAAGCACATCGAAAAAGACCCGGCCCTGACCCGCCGTTTCCAAGTGGTGCAAGTGGCCGAGCCGTCGG
AAGACAAGGCCCTGCTGATGATGCGCGGCGTGGCCTCGACCATGGAAAAACACCACCAGGTGCAGATCCT
CGACGAAGCCCTGGAAGCCTCGGTCAAGCTGTCCCACCGCTACATTCCCGCGCGCCAGCTGCCGGACAAA
TCCGTGAGCCTGCTGGACACCGCTTGCGCCCGCGTCGCCATCAGCCTGCACGCCGTACCGGCCGAAGTGG
ACGACAGCCGTCGGCGCATCGAAGCGCTGGAAACCGAGCTGCAAATCATCGCCCGTGAACACGCGATTGG
CGTGGTCATCGGCAGCCGCCAGACCCAGAGCGAAACCCTGCTGAGCGCCGAGCGCGAACGCCTGGCCGAG
CTGGAAGGCCGCTGGGCCGAAGAGAAAACCCTGGTGGACGAACTGCTCGCCACCCGCGCCACCCTGCGCG
AGCGCGTTGGCGTGGTGGACAGCGAGGACAACAGCGAAGCTTCTGACAACGAAAGCCACCAACTGCGTGA
GAAACTGGTGGACCTGCAACAGCGCCTGACGGCCCTGCAAGGCGAAACTCCGCTGATCCTGCCGACCGTG
GATTACCAGGCCGTGGCCTCGGTGGTCGCCGACTGGACCGGTATCCCGGTGGGCCGCATGGCCCGCAACG
AACTGGAAACCGTGCTCAACCTCGACCAGCACCTGAAGAAACGCATCATCGGCCAGGACCATGCCTTGCA
GATGATCGCCAAGCGCATCCAGACCTCCCGCGCCGGCCTCGACAACCCGAGCAAGCCGATTGGTGTGTTC
ATGCTTGCCGGCACTTCCGGCGTGGGCAAGACCGAAACCGCCCTGGCCCTGGCCGAAGCCATGTACGGCG
GCGAGCAGAACGTTATCACCATCAACATGAGCGAGTTCCAGGAAGCCCACACCGTGTCGACCCTCAAGGG
CGCGCCACCGGGCTACATCGGCTATGGCGAAGGCGGCGTGCTGACCGAGGCCGTGCGGCGCAAACCGTAC
AGCGTGGTGTTGCTGGACGAGGTGGAAAAGGCCCACCCGGACGTGCATGAGATCTTCTTCCAGGTGTTCG
ACAAAGGCGTGATGGAGGACGGCGAAGGCCGGGTGATCGACTTCAAGAACACCTTGATCCTGCTGACCAC
CAACGCCGGCACCGAGTTGATCGCCCAGGTCTGCAAAGACCCGCAGAACGTGCCCGAGCCGGAAGAAATC
GCCAAGGCCCTGCGCCAACCGCTGCTGGAGATTTTCCCGCCGGCCTTGCTGGGCCGCCTGGTGACGATCC
CGTACTACCCGCTCAGCGACGAGATGCTCAAGGCCATCACCCGCCTGCAACTCAACCGCATCAAGAAGCG
CGTGGAAAGCACCCACAAAGTCGCCTTCGACTACGACGACGCGGTGATCGATTTGATCGTCTCGCGTTGC
ACCGAAACCGAAAGCGGCGGGCGCATGATCGACACCATCCTGACCAACAGCCTGCTGCCGGACATGAGCC
GCGAGTTCCTGACCCGCATGCTCGAAGGCAAGGCTTTGGCCGGGGTGCGGATCAGCGCCGTGGATAACGA
ATTGCAGTACGATTTCAGCGACGCGGCCTGA