SecReT6
Protein ID: 378953699
SecReT6 ID541
T6SS typei1
Gene symbolimpK3
Locus tagPSF113_5818
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6712280..6713143 [-]
Productprotein ImpK
NoteTssL
UniProt IDG8Q736
KEGG IDpfe:PSF113_5818
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-63, Aligned region: 59..264
Protein Sequence: 287 a.a.     [Download]
>gi|378953699|ref|YP_005211187.1| protein ImpK [Pseudomonas fluorescens F113]
MDKENPQDETTVLLDHHGQRPVSGPLTDAVAPPRFEQLQERMIYAAHLPRSQALNVSLNPLVAAASGLLS
QMVQLKHGREREDLQALKGELKRGLEQFEACALQDGVENSQLIAARYVLCSAIDEAIVTTPWGHGGGWSQ
ISLLSTFHNETFGGEKVFQLLERLSKNPIKHLSMLELLYLCLSLGFEGKYRVQTRGMLELESLRDALYRL
ICQARGDIPRELSPRWEGFDGARRSPVRIVPAWTVAVFTLVCLGVVYSSFAWVLDEQRRSVLQPYQLSEP
VAAQPLP
 
Nucleotide Sequence: 864 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6713143-6712280 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGATAAGGAAAATCCCCAGGACGAAACAACCGTCCTGCTCGACCACCATGGACAACGTCCTGTTTCTG
GACCCTTGACCGACGCTGTTGCGCCGCCACGTTTCGAACAGTTGCAAGAGCGAATGATCTACGCCGCGCA
CCTGCCGCGGTCCCAGGCCCTCAATGTCAGCCTTAATCCGCTGGTCGCGGCGGCGTCCGGATTGTTGTCG
CAAATGGTGCAACTCAAGCACGGCCGCGAACGCGAGGACCTGCAAGCCCTCAAAGGGGAACTGAAGCGAG
GCCTGGAGCAGTTCGAAGCCTGTGCCTTGCAGGACGGTGTTGAAAACAGTCAGTTGATCGCGGCGCGTTA
CGTGCTCTGCTCAGCGATCGACGAGGCGATCGTCACTACACCGTGGGGCCATGGAGGTGGGTGGTCACAG
ATAAGCCTGCTCAGCACTTTCCACAACGAAACCTTCGGCGGCGAGAAGGTCTTTCAATTGCTTGAGCGCT
TGTCGAAAAACCCCATCAAGCACCTGTCGATGCTTGAGTTGTTGTATCTGTGCCTGTCCCTGGGCTTCGA
GGGCAAGTATCGGGTGCAGACCCGTGGGATGCTCGAGCTCGAAAGTCTGCGCGATGCACTGTATCGGCTG
ATCTGCCAGGCACGCGGTGACATCCCTCGTGAACTGTCGCCTCGCTGGGAAGGCTTCGATGGCGCGCGAC
GCAGCCCAGTGCGCATTGTTCCGGCCTGGACGGTAGCGGTTTTTACGCTGGTCTGCCTGGGGGTGGTGTA
CTCGAGTTTCGCCTGGGTATTGGACGAGCAACGCCGAAGCGTACTGCAACCTTATCAACTGTCAGAGCCG
GTCGCCGCTCAGCCGCTACCGTAA