SecReT6
Protein ID: 378953700
SecReT6 ID541
T6SS typei1
Gene symbolimpJ3
Locus tagPSF113_5819
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6713149..6714480 [-]
Productprotein ImpJ
NoteTssK
UniProt IDG8Q737
KEGG IDpfe:PSF113_5819
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-139, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|378953700|ref|YP_005211188.1| protein ImpJ [Pseudomonas fluorescens F113]
MNHDKVVWQEGMLLRPQHLQHNDRYFDHQLKVRTRLLASYAWGFLALEIDLQFLNMGQLVVSQASGVLPD
GSLFELGGNTEPLALEVPSNTSNTPIYLALPLVTGNHIESRRPEQSDVLARYTIYDAQVTDSNAGDSGGS
QISCGRPDLRLLLGEQQSDHAFVKLKLCEVLDTTADGLIRLDPDFVPTFIQARSSHYLLSCLKEIIGMLA
HRGDSLAERIRFNGKAGGAQVGDFMMLQLINRSELLLRHYLDLEQVHPETLYRMLLALLGELATFSSDSK
RPPLTNRYQHSDQGACFRSLMQAIRQVLSMVLEQHAIELQLQPRQYGITVSPMQDLTLLDTASFVLAASA
NCDSEELRHRLPSNLKVGSVERIRQLVNLHLPGIKIRPLPVAPRQIAFHANKTYFILEPSSEDLAQLKRS
AGFAFHVCGDFAELELNFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6714480-6713149 Pseudomonas fluorescens F113 chromosome, complete genome
ATGAATCACGATAAAGTCGTCTGGCAAGAAGGCATGTTGTTGCGTCCACAACATTTGCAACACAACGATC
GTTATTTCGATCACCAGTTGAAGGTTCGTACCCGGTTGCTGGCCAGTTACGCCTGGGGATTCCTGGCGCT
GGAAATCGATCTGCAATTTCTCAACATGGGCCAACTGGTGGTCAGCCAGGCCAGCGGGGTCCTGCCGGAC
GGCAGCCTGTTCGAGCTCGGTGGCAACACCGAGCCGTTGGCCCTGGAAGTACCGTCCAATACCAGCAATA
CACCGATCTACCTCGCGCTGCCATTGGTGACCGGCAACCACATCGAGTCCCGTCGTCCGGAGCAATCTGA
TGTGCTGGCGCGCTACACCATCTACGACGCGCAGGTGACCGACTCCAACGCCGGCGATTCCGGCGGGAGC
CAGATCAGTTGTGGCCGGCCGGACCTGCGCCTGCTGTTGGGCGAGCAACAGAGCGACCATGCGTTTGTGA
AGCTCAAGCTCTGTGAGGTGCTCGATACCACTGCTGATGGGCTGATCAGGCTCGACCCGGACTTTGTGCC
AACCTTCATCCAGGCTCGTTCATCCCATTATTTGCTGTCGTGTCTCAAGGAGATCATCGGCATGCTTGCC
CATCGGGGTGACAGCCTTGCCGAGCGGATCCGCTTCAATGGCAAGGCCGGTGGTGCGCAAGTGGGCGATT
TCATGATGCTGCAACTAATCAATCGTAGCGAACTGTTGCTACGTCATTATCTGGATCTGGAGCAAGTACA
TCCCGAAACACTCTACCGAATGCTACTGGCCCTGTTGGGTGAACTGGCGACGTTCTCCAGTGACAGCAAG
CGTCCACCGCTCACCAACCGCTACCAGCACAGCGACCAGGGCGCATGTTTTCGAAGCCTGATGCAGGCGA
TCCGCCAGGTGCTGTCGATGGTGCTCGAGCAGCACGCTATCGAGCTGCAATTGCAGCCGCGCCAATATGG
AATCACCGTCTCGCCGATGCAGGACCTCACCCTGCTGGATACGGCTTCATTCGTACTGGCGGCTAGCGCC
AACTGTGACAGCGAAGAGTTGCGCCATCGACTGCCGTCGAACCTCAAGGTTGGCTCGGTGGAGCGCATCC
GCCAGTTGGTCAACCTGCATCTGCCCGGTATCAAGATCAGGCCTCTGCCCGTGGCTCCGCGGCAGATCGC
ATTCCATGCCAACAAAACCTATTTCATCCTGGAGCCCAGCTCCGAAGACCTGGCGCAACTGAAGCGCTCG
GCAGGCTTCGCGTTCCATGTGTGCGGTGATTTCGCGGAGCTTGAACTGAATTTTTGGGCCATCAGGAATT
GA