SecReT6
Protein ID: 378953701
SecReT6 ID541
T6SS typei1
Gene symbolvasD2
Locus tagPSF113_5820
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6714477..6714980 [-]
Productprotein VasD
NoteTssJ
UniProt IDG8Q738
KEGG IDpfe:PSF113_5820
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.30E-38, Aligned region: 19..154
Protein Sequence: 167 a.a.     [Download]
>gi|378953701|ref|YP_005211189.1| protein VasD [Pseudomonas fluorescens F113]
MSHCTMHLFKTLTALAMTLLLGGCTTLSPFSTMTKLDLALTASDRLNPDLNGRPSPVVVRLFELRHPVAF
ENSDFFSLYERGRETLAPDLVSSEELELRPGETVELRLGITGDGRYVGILAAYRDLPHARWRYTLPVAAT
QLTEANLTLDQDGIANTLERQAKVDDR
 
Nucleotide Sequence: 504 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6714980-6714477 Pseudomonas fluorescens F113 chromosome, complete genome
ATGTCGCACTGCACGATGCACTTATTCAAGACTTTGACGGCGCTGGCCATGACCCTGCTATTGGGCGGTT
GCACCACGTTGTCGCCCTTTTCGACGATGACCAAGCTCGACCTCGCCCTGACGGCCAGTGATCGGCTCAA
CCCCGATCTCAATGGGCGGCCATCGCCAGTGGTGGTACGGCTGTTCGAGCTCAGGCATCCGGTAGCCTTT
GAAAACTCGGATTTTTTCAGCCTCTATGAGCGCGGGAGGGAGACATTGGCCCCCGATCTGGTTTCCAGCG
AAGAGCTGGAACTGCGCCCAGGTGAGACCGTCGAGCTCAGGCTCGGTATCACTGGGGATGGCCGTTACGT
CGGCATACTCGCGGCGTACCGGGACCTGCCACACGCTCGCTGGCGCTACACACTGCCAGTGGCTGCGACG
CAGTTGACCGAAGCGAACCTGACCCTCGACCAGGATGGGATCGCCAACACGCTTGAAAGACAGGCCAAGG
TAGATGACCGATGA