SecReT6
Protein ID: 378953702
SecReT6 ID541
T6SS typei1
Gene symbolimpI3
Locus tagPSF113_5821
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6714986..6715837 [-]
Productprotein ImpI
NoteFha
UniProt IDG8Q739
KEGG IDpfe:PSF113_5821
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.20E-11, Aligned region: 29..93
Protein Sequence: 283 a.a.     [Download]
>gi|378953702|ref|YP_005211190.1| protein ImpI [Pseudomonas fluorescens F113]
MDLVFEMLNANQFVPVRLFHKTFGPAGGVIGRGEGCHWMIPDRDRLLSNCHAQVSFREGAFFLTDTSGNG
TTHRESGARLPKGEPVRIQDGDAYIMGEFEVLARLVVGPSSSVAEAARSTSVDSLIPDDAFLELDPLKAL
DQQERVLLDIDELINPTAVPPDTLGRPDYARIDMESLLLPELVEELVEPRPAPIPRANAMDHPREDFWER
FAIALGMDLESLDSEARETLAINAALLLKQSIHGLQQSLRTRSELKGEPRLTQTQTYEEQVRLIASLQID
HHG
 
Nucleotide Sequence: 852 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6715837-6714986 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGATCTTGTTTTCGAAATGCTGAACGCCAACCAGTTCGTCCCTGTACGGCTGTTTCACAAGACTTTCG
GACCGGCCGGCGGAGTGATTGGTCGGGGCGAGGGCTGCCACTGGATGATCCCTGACCGCGACCGCCTGCT
GTCCAACTGTCACGCGCAGGTCAGCTTCCGTGAGGGCGCGTTTTTCCTGACCGATACCAGTGGCAACGGT
ACGACCCACCGCGAAAGCGGTGCGCGCCTGCCCAAGGGCGAGCCGGTACGGATACAGGACGGAGACGCCT
ACATCATGGGTGAATTCGAGGTCCTGGCGCGCCTGGTCGTCGGGCCGTCGAGCAGCGTTGCCGAAGCCGC
TCGCTCAACGTCGGTCGACAGTCTCATTCCGGACGATGCCTTTCTGGAACTCGACCCGCTGAAAGCACTG
GACCAACAGGAGCGGGTCTTGCTGGACATCGATGAGCTGATAAATCCCACTGCCGTACCACCAGACACCC
TTGGGCGCCCAGATTATGCGCGTATCGACATGGAAAGCCTGCTGTTGCCGGAGTTGGTCGAAGAGCTCGT
TGAACCAAGGCCTGCGCCCATCCCTCGTGCCAACGCTATGGATCACCCGCGCGAAGATTTTTGGGAGCGC
TTCGCTATTGCCCTCGGCATGGATCTCGAAAGCCTTGATAGCGAGGCCCGCGAAACCCTGGCGATCAATG
CAGCGCTGCTGCTCAAGCAAAGCATCCATGGTTTGCAGCAGAGCTTGCGTACCCGCTCGGAGTTGAAAGG
CGAACCGCGCCTGACCCAGACCCAGACCTATGAAGAACAGGTTCGTCTGATTGCCAGCCTGCAAATCGAT
CACCACGGATGA