SecReT6
Protein ID: 378953704
SecReT6 ID541
T6SS typei1
Gene symbolclpB4
Locus tagPSF113_5823
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6717583..6720168 [-]
Productchaperone ClpB
NoteTssH
UniProt IDG8Q741
KEGG IDpfe:PSF113_5823
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-41, Aligned region: 206..284
AAA_2 [PF07724], Evalue: 1.90E-41, Aligned region: 595..758
AAA [PF00004], Evalue: 2.20E-18, Aligned region: 208..339
AAA [PF00004], Evalue: 2.20E-18, Aligned region: 600..694
AAA_5 [PF07728], Evalue: 2.90E-12, Aligned region: 208..228
AAA_5 [PF07728], Evalue: 2.90E-12, Aligned region: 267..338
AAA_5 [PF07728], Evalue: 2.90E-12, Aligned region: 599..718
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 7..73
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 106..142
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 185..231
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 570..632
AAA_16 [PF13191], Evalue: 2.70E-09, Aligned region: 664..693
AAA_22 [PF13401], Evalue: 3.70E-09, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 3.70E-09, Aligned region: 598..693
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 208..261
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 454..477
AAA_17 [PF13207], Evalue: 1.10E-06, Aligned region: 598..620
ClpB_D2-small [PF10431], Evalue: 2.70E-06, Aligned region: 770..837
Clp_N [PF02861], Evalue: 8.40E-06, Aligned region: 30..72
Clp_N [PF02861], Evalue: 8.40E-06, Aligned region: 102..122
Sigma54_activat [PF00158], Evalue: 1.40E-05, Aligned region: 203..224
Sigma54_activat [PF00158], Evalue: 1.40E-05, Aligned region: 598..716
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 208..235
NACHT [PF05729], Evalue: 1.80E-05, Aligned region: 599..636
AAA_29 [PF13555], Evalue: 5.70E-05, Aligned region: 199..224
AAA_29 [PF13555], Evalue: 5.70E-05, Aligned region: 597..624
IstB_IS21 [PF01695], Evalue: 5.80E-05, Aligned region: 202..231
IstB_IS21 [PF01695], Evalue: 5.80E-05, Aligned region: 599..617
AAA_18 [PF13238], Evalue: 0.00058, Aligned region: 208..228
AAA_18 [PF13238], Evalue: 0.00058, Aligned region: 600..625
AAA_23 [PF13476], Evalue: 0.0012, Aligned region: 208..224
AAA_23 [PF13476], Evalue: 0.0012, Aligned region: 443..490
AAA_23 [PF13476], Evalue: 0.0012, Aligned region: 597..627
AAA_19 [PF13245], Evalue: 0.0014, Aligned region: 205..230
AAA_19 [PF13245], Evalue: 0.0014, Aligned region: 353..383
AAA_19 [PF13245], Evalue: 0.0014, Aligned region: 596..621
DUF258 [PF03193], Evalue: 0.002, Aligned region: 90..120
DUF258 [PF03193], Evalue: 0.002, Aligned region: 176..226
DUF258 [PF03193], Evalue: 0.002, Aligned region: 598..616
AAA_25 [PF13481], Evalue: 0.0025, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.0025, Aligned region: 542..586
AAA_25 [PF13481], Evalue: 0.0025, Aligned region: 597..627
RNA_helicase [PF00910], Evalue: 0.0047, Aligned region: 209..229
RNA_helicase [PF00910], Evalue: 0.0047, Aligned region: 600..620
SRP54 [PF00448], Evalue: 0.0059, Aligned region: 208..231
SRP54 [PF00448], Evalue: 0.0059, Aligned region: 598..620
AAA_30 [PF13604], Evalue: 0.0079, Aligned region: 200..231
AAA_30 [PF13604], Evalue: 0.0079, Aligned region: 598..620
Mg_chelatase [PF01078], Evalue: 0.0097, Aligned region: 206..246
Mg_chelatase [PF01078], Evalue: 0.0097, Aligned region: 568..620
Mg_chelatase [PF01078], Evalue: 0.0097, Aligned region: 669..688
Protein Sequence: 861 a.a.     [Download]
>gi|378953704|ref|YP_005211192.1| chaperone ClpB [Pseudomonas fluorescens F113]
MINVDLQQLIQALDAETRSDLSRSAEQCVARGADKVLVEDLMLGLLERPQGLLARALQDAQVSAGELSAA
LQPRMGHSASRNPVFAPELVQWLQDALLVANLELGCSQVGQAALILALLRNPLRYAGSAYQALLTRLNVD
RLKDFALSQQTHPVADHSAKPDDSLLARFTHDLTRQAREGQLDPVLCRDGEVRQMIDILVRRRKNNPIVV
GEAGVGKTAIVEGLALRIAAAEVPSVLEGVELLSLDMGLLQAGASIKGEFERRLKGVIDEVKASPKSIIL
FIDEAHTLIGAGGNAGGADAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPTVSE
AVTILRGLARVYENSHGIYLRDDAVVAAAQLSARYLAGRQLPDKAVDVLDTACARVRISLAAAPHSLERL
RGELAEGERQRQALRRDAQAGLSIDLQALEALEVRLEAIEDERRTLEIHWTEQRILAERLLALRQQLAKV
RDGAVDQPLSVEALEAALHETHGTLVAAQVQERLVSFEVCPRLVAEVISAWTGVPLAQLAREHSLKVASF
ATDLRARIRGQEPAVRALDRAMRAAAAGLNKPDAPVGVFLLVGPSGVGKTETAHALADLLYGGDRFITTL
NMAEFQEKHTVSRLIGAPPGYVGFGEGGMLTEAVRQKPYSVVLLDEVEKTDPDVLNLFYQIFDKGLANDG
EGREIDFRNTLILMTSNLGSERINELCENGTKPSAECLEESIRPILSQHFKPALLARMCVVPYYPLNGPV
LRELVEVKLDHLGERLHRRQLGFSYCGHLVNHLVERCSRNDRGARLIDQLLDLHLMPLVADRLLAAMAGG
EQLRHVHAVLNGDASLACEFS
 
Nucleotide Sequence: 2586 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6720168-6717583 Pseudomonas fluorescens F113 chromosome, complete genome
ATGATCAACGTAGACCTTCAGCAACTGATCCAGGCGTTGGACGCCGAAACCAGAAGCGATCTGTCGCGCT
CGGCCGAGCAATGCGTCGCCCGTGGGGCAGACAAAGTCCTGGTGGAAGACTTGATGCTGGGCTTGCTGGA
ACGTCCGCAGGGGCTGCTCGCGCGAGCCTTGCAAGATGCCCAGGTAAGCGCAGGTGAACTGAGCGCTGCG
CTGCAACCACGGATGGGGCACAGCGCTTCGCGCAATCCGGTATTCGCCCCGGAGCTGGTGCAATGGTTGC
AGGATGCACTGCTGGTAGCCAATCTCGAGCTGGGCTGCAGCCAGGTCGGACAAGCCGCGTTGATCCTGGC
GTTGCTGCGCAACCCGCTTCGCTATGCAGGGAGTGCTTACCAGGCGCTGCTCACCCGACTGAACGTCGAT
CGGTTGAAAGATTTCGCCTTGTCGCAACAGACCCACCCGGTAGCCGATCACTCCGCCAAGCCGGACGACT
CCCTGCTGGCGCGCTTCACCCATGACCTGACCCGGCAGGCTCGTGAAGGTCAACTCGACCCGGTGCTTTG
TCGCGACGGTGAAGTCAGGCAGATGATCGATATCCTCGTTCGTCGCCGCAAAAATAACCCAATCGTGGTC
GGTGAAGCAGGGGTGGGCAAGACCGCCATCGTCGAGGGGCTGGCGTTGCGCATCGCCGCCGCAGAAGTAC
CGTCAGTGCTCGAAGGCGTCGAGCTGCTTTCGCTGGATATGGGGCTCCTGCAGGCCGGCGCCAGCATAAA
AGGTGAATTCGAACGTCGTCTCAAAGGGGTGATCGACGAGGTCAAGGCTTCGCCAAAATCCATCATCCTG
TTCATCGATGAGGCTCACACCTTGATTGGCGCGGGTGGCAACGCCGGGGGCGCCGATGCGGCCAACCTGC
TCAAGCCGGCCTTGGCCCGGGGTGAGCTGCGTACTATCGCGGCCACCACCTGGGCCGAGTACAAAAAATA
TTTTGAGAAAGACCCGGCCCTGGCCCGTCGTTTCCAACCGGTGCAATTGCACGAGCCGACCGTCAGTGAA
GCAGTGACCATCCTGCGCGGCCTGGCCCGGGTCTACGAGAACAGTCACGGCATTTACCTGCGGGATGATG
CGGTGGTCGCGGCGGCGCAATTGTCGGCCCGCTACCTGGCTGGTCGTCAGTTGCCAGACAAGGCTGTGGA
TGTGTTGGACACTGCCTGCGCCCGCGTGCGCATCAGCCTGGCCGCTGCGCCGCATAGCCTGGAGCGATTG
CGCGGCGAGTTGGCTGAAGGCGAGCGCCAGCGCCAGGCGCTACGTCGTGATGCGCAGGCCGGCCTATCAA
TTGATCTTCAGGCGCTGGAAGCGCTGGAGGTACGCCTGGAGGCCATCGAAGACGAGCGCCGAACGCTGGA
GATCCACTGGACCGAGCAACGCATTCTTGCGGAGCGCCTGTTGGCGCTTCGCCAGCAATTGGCCAAGGTA
CGGGACGGTGCGGTGGATCAACCCCTCAGCGTCGAAGCCTTGGAAGCGGCGTTGCATGAAACACACGGCA
CGTTGGTGGCTGCGCAAGTCCAAGAGCGCCTGGTCAGCTTCGAAGTTTGCCCGCGACTGGTAGCCGAAGT
CATCAGTGCCTGGACCGGTGTGCCGCTGGCACAACTGGCGCGGGAGCACAGTTTGAAAGTCGCCAGTTTC
GCGACGGACCTGCGTGCTCGTATTCGTGGTCAGGAGCCGGCTGTGCGGGCGCTTGATCGCGCGATGCGTG
CCGCCGCCGCAGGCCTGAACAAACCCGACGCTCCGGTGGGCGTGTTTCTGTTGGTAGGGCCCAGTGGCGT
CGGCAAGACCGAGACGGCGCATGCCCTGGCCGACCTGCTCTACGGCGGTGATCGTTTTATCACCACGCTC
AACATGGCCGAATTCCAGGAGAAACATACGGTTTCCCGGCTGATTGGCGCGCCGCCGGGCTACGTCGGTT
TTGGCGAAGGCGGCATGCTCACCGAAGCCGTGCGGCAAAAGCCCTATTCAGTGGTGCTGCTCGATGAGGT
CGAAAAAACCGACCCGGATGTGTTGAATCTGTTCTACCAGATCTTCGACAAGGGCTTGGCCAACGACGGA
GAAGGGCGGGAGATTGATTTTCGCAACACCCTGATCCTGATGACGTCGAACCTGGGCAGCGAACGCATCA
ACGAGTTGTGCGAAAACGGTACAAAACCAAGTGCCGAATGCCTTGAAGAGTCCATTCGCCCAATACTCAG
TCAACATTTCAAACCCGCGCTGTTGGCGCGCATGTGCGTGGTGCCGTACTACCCGCTCAACGGGCCGGTG
TTACGTGAACTGGTGGAAGTCAAACTCGACCACCTGGGCGAGCGGCTGCACCGTCGTCAATTGGGTTTCA
GTTATTGCGGGCACCTTGTGAACCACCTGGTCGAGCGTTGCAGTCGTAATGATCGTGGCGCACGACTGAT
TGACCAACTGCTTGACCTGCACCTGATGCCGCTGGTTGCCGACCGGTTGCTCGCCGCCATGGCCGGTGGC
GAACAGCTACGGCACGTACACGCCGTGCTCAACGGCGACGCCAGTCTCGCGTGTGAGTTCTCCTGA