SecReT6
Protein ID: 378953705
SecReT6 ID541
T6SS typei1
Gene symbolimpH3
Locus tagPSF113_5824
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6720180..6721184 [-]
Productprotein ImpH
NoteTssG
UniProt IDG8Q742
KEGG IDpfe:PSF113_5824
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.90E-83, Aligned region: 19..319
Protein Sequence: 334 a.a.     [Download]
>gi|378953705|ref|YP_005211193.1| protein ImpH [Pseudomonas fluorescens F113]
MDTPHGPAAASINGLTRGIREYSLFQAVLLVVDRLREAYPDLDDEALYDRLEFQANPSLGFPASDIDRVE
FFEENGQVRARLGMNLISLVGAGSPLPAFYGEQALGEEEGNPTRDFLDVFHHRLQRLMLPIWRKYRYCAS
FRSGAKDPFSEQLFALIGLGGEDIRKASQLNWKRLLPYLGLLSLRAHSAALIEAVLRYYFKHAELNLEQC
IERRVDILGEQRNRLGSANSLLSQDLVLGEQVRDRSGKFRIHISELDWQRFHEFLPIGIGYLPLCSLVRF
TLRDPLEYDIRLVLRRQDIRELCIGEQNICRLGWTSWLGYERADGVVTLGSKIH
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6721184-6720180 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGACACCCCGCATGGGCCAGCAGCCGCTTCTATAAACGGGCTGACGCGAGGGATACGCGAGTACTCGT
TATTTCAGGCCGTGTTGTTGGTCGTTGATCGGCTGCGCGAGGCTTACCCTGACCTGGATGATGAGGCGCT
GTATGACCGGCTGGAGTTCCAGGCCAACCCAAGCCTGGGGTTCCCCGCCAGCGACATCGATCGTGTGGAG
TTTTTCGAAGAAAACGGCCAGGTGCGAGCGCGCCTGGGCATGAACCTGATCAGCCTGGTAGGAGCAGGGT
CGCCGCTACCGGCGTTCTATGGTGAGCAGGCCCTAGGGGAGGAGGAGGGCAATCCGACGCGCGACTTCCT
CGACGTCTTCCACCACCGTCTTCAACGACTGATGCTGCCGATCTGGCGCAAGTATCGTTACTGCGCAAGT
TTTCGGAGCGGTGCTAAAGACCCTTTTTCCGAGCAGTTGTTTGCGCTGATCGGCCTGGGCGGCGAAGACA
TTCGCAAGGCCAGTCAACTGAACTGGAAGCGTCTGCTGCCGTATCTGGGCCTGCTGAGTCTTCGTGCTCA
TTCGGCAGCTCTGATCGAGGCCGTGCTGCGTTATTACTTCAAGCACGCCGAACTGAACCTTGAGCAGTGC
ATCGAGCGGCGTGTGGACATCCTTGGCGAACAGCGCAATCGCCTGGGGAGCGCCAATAGCCTGCTGAGCC
AAGACCTGGTGCTGGGTGAACAGGTGCGCGACCGCAGCGGCAAGTTCCGGATCCATATCAGCGAACTGGA
CTGGCAGCGTTTTCACGAATTCCTGCCCATCGGCATCGGTTACCTGCCGTTGTGCTCACTGGTGCGTTTC
ACCCTGCGTGATCCCCTCGAATATGACATTCGCCTGGTCCTGCGCCGGCAGGACATTCGGGAGCTGTGCA
TCGGAGAACAGAACATCTGCCGCCTGGGATGGACCAGTTGGTTGGGGTACGAGCGCGCCGATGGCGTGGT
GACCCTCGGCAGCAAAATTCATTAG