SecReT6
Protein ID: 378953706
SecReT6 ID541
T6SS typei1
Gene symbolimpG3
Locus tagPSF113_5825
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6721148..6722935 [-]
Productprotein ImpG
NoteTssF
UniProt IDG8Q743
KEGG IDpfe:PSF113_5825
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-187, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|378953706|ref|YP_005211194.1| protein ImpG [Pseudomonas fluorescens F113]
MSFNHYYQSELTALRQLGRRFAERNPALAPFLGQVGRDPDVERLLEGFAFLTGRLRQKLDDQLPELSHSL
MQLLWPNYMRPLPAFSILQFDPLQRSGPALRVERDTPVESKPVQQVRCRFLTCYPTEVLALDLTGLSYSV
KGDGSLLSLRLEMCCDGHLGELQLSQLRLHLTGERYISQMLYLSLLRNLEGIELIPLDGSGEALRATDGS
PMRFRIPADRVQPVGFAEEEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVNGLDVINAAPRSSVEQMRG
LELRFDIGKSGIQRMRPTLDNIKLHCTPIVNLFKHDAQPIRLDSKQDEYLLLPADYDQEHCGVFSVESVT
GWNPGGLGYQAYVPFESFEHDSSFDVPHSRPYYSVRQRPSLLHGGLDTCLGFGARHNHPHETLSIELMCT
NQNLPRQLKPGDIDQPGEKSPESLSFRNIGPVTSSFAPPLNRDFLWKLISNMSLNYLSLADVNALKVILE
TYDFPRYYDEQTEKVSKRLLDGLKSIRHQHVDRLHRGLPVRGLRTELTIDPQGYIGEGDLFVFASVLNEF
FALYASLNSYHELRVNSTQGEVYQWTPRMGQQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6722935-6721148 Pseudomonas fluorescens F113 chromosome, complete genome
ATGTCGTTCAATCATTACTACCAGAGCGAGCTGACGGCACTCCGCCAGTTGGGTCGACGTTTCGCCGAGC
GTAACCCGGCGTTGGCCCCCTTTCTGGGGCAGGTCGGACGGGACCCGGATGTGGAGCGGCTGCTGGAGGG
GTTTGCATTCCTGACCGGGCGGCTGCGCCAGAAGCTCGATGACCAATTGCCGGAGCTGAGTCATTCGCTG
ATGCAGCTGTTGTGGCCGAACTACATGCGGCCGTTGCCGGCCTTCAGCATCTTGCAGTTCGATCCACTAC
AACGGTCCGGCCCCGCACTGCGGGTGGAGCGTGATACGCCGGTCGAAAGCAAGCCTGTGCAGCAGGTGCG
TTGCCGTTTCCTGACGTGTTACCCAACCGAGGTGCTGGCGCTTGATCTGACCGGGTTGAGCTATTCGGTG
AAAGGGGATGGGTCGCTGTTGAGCCTGCGCCTGGAGATGTGTTGCGACGGTCATTTGGGCGAACTGCAAC
TGAGCCAATTGCGTCTGCACTTGACCGGCGAGCGTTACATCAGCCAGATGCTCTACCTCAGCCTTTTGCG
CAATCTTGAAGGTATCGAGCTGATCCCGCTGGACGGCTCCGGCGAGGCCCTGCGGGCTACAGATGGCAGC
CCTATGAGGTTCAGGATCCCTGCCGATCGTGTCCAGCCGGTAGGGTTTGCCGAAGAGGAAGCGCTGATCC
CGTATCCGCTGAATACCTTTCGCGGCTATCGCTACTTGCAGGAGTACTTCGCTTTCCAGGACAAGTTCCT
GTTCGTCGACGTCAATGGCCTGGACGTGATCAACGCTGCTCCGCGCAGCAGCGTCGAACAGATGCGGGGG
CTGGAGCTGCGCTTCGATATTGGCAAAAGCGGTATCCAGCGGATGCGCCCGACACTGGACAACATAAAGC
TTCACTGCACGCCGATCGTCAATCTGTTCAAGCATGACGCCCAGCCAATCCGCCTGGACAGCAAACAGGA
CGAATACCTGTTGCTGCCGGCCGATTATGACCAGGAGCACTGCGGTGTGTTCTCGGTCGAAAGCGTCACC
GGCTGGAACCCCGGCGGCCTGGGTTATCAGGCCTATGTGCCGTTCGAATCCTTCGAGCACGATTCAAGCT
TCGATGTGCCCCACAGCCGACCCTACTACAGCGTTCGTCAGCGCCCTTCATTGCTGCACGGTGGCCTGGA
CACCTGCCTAGGCTTCGGTGCCCGGCACAATCACCCTCATGAAACCCTGTCGATCGAGTTGATGTGCACC
AACCAGAACCTGCCGCGCCAGCTCAAGCCGGGTGACATCGACCAGCCCGGCGAAAAAAGCCCCGAGTCGC
TGAGTTTCCGCAACATCGGGCCGGTCACTTCGAGCTTCGCTCCCCCGCTCAACCGCGATTTCCTCTGGAA
GCTGATCAGCAACATGTCACTCAACTACCTGTCGCTGGCGGACGTCAATGCACTCAAGGTGATTCTCGAA
ACCTACGATTTTCCGCGCTACTACGACGAGCAGACAGAGAAGGTCAGCAAGCGTTTGCTGGATGGGCTCA
AGTCGATCAGGCACCAGCATGTCGACCGCCTGCATCGAGGCTTGCCGGTTCGTGGCTTGCGCACCGAATT
GACCATCGACCCCCAGGGCTACATCGGCGAGGGCGACCTGTTCGTCTTCGCCTCGGTACTCAACGAATTC
TTCGCGCTTTATGCCAGCCTCAATTCGTACCACGAACTGCGGGTGAACAGTACACAAGGAGAGGTCTATC
AATGGACACCCCGCATGGGCCAGCAGCCGCTTCTATAA