SecReT6
Protein ID: 378953707
SecReT6 ID541
T6SS typei1
Gene symboltssE2
Locus tagPSF113_5826
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6722942..6723352 [-]
Productprotein TssE2
NoteTssE
UniProt IDG8Q744
KEGG IDpfe:PSF113_5826
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-17, Aligned region: 28..114
Protein Sequence: 136 a.a.     [Download]
>gi|378953707|ref|YP_005211195.1| protein TssE2 [Pseudomonas fluorescens F113]
MTYGSLFERLAGDSEKRAGLSREMCVVTSVAAHLAKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDAGSQA
RKAIEAFIKAYEPRLRNVCVVSIPSHADPLRLSFSIDALLDVEGVRRQVSFSACLDGSGQVKVRQG
 
Nucleotide Sequence: 411 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6723352-6722942 Pseudomonas fluorescens F113 chromosome, complete genome
ATGACGTATGGCAGCCTTTTCGAGCGCCTGGCCGGTGATTCAGAAAAGCGCGCGGGCTTGAGCCGTGAGA
TGTGTGTCGTGACATCGGTGGCTGCGCATCTGGCCAAGATGCTCAGCACCCGGGCAGGTAGCGTGCAGAC
GCTATCCGATTATGGGCTACCGGATCTCAATGACATGCGCTTGAGCCTGCACGACGCAGGGAGCCAGGCC
CGCAAGGCGATCGAGGCGTTCATCAAGGCCTACGAGCCACGCCTCAGGAATGTCTGTGTCGTTTCAATAC
CAAGTCATGCCGATCCGCTTCGCCTGTCCTTCAGCATCGACGCTTTGCTGGATGTGGAGGGGGTCAGGCG
ACAGGTCAGTTTTTCCGCGTGCCTGGACGGCAGCGGTCAGGTCAAGGTCAGACAAGGATAG