SecReT6
Protein ID: 378953709
SecReT6 ID541
T6SS typei1
Gene symbolimpB3
Locus tagPSF113_5828
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6724862..6725365 [-]
Productprotein ImpB
NoteTssB
UniProt IDG8Q746
KEGG IDpfe:PSF113_5828
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-51, Aligned region: 6..159
Protein Sequence: 167 a.a.     [Download]
>gi|378953709|ref|YP_005211197.1| protein ImpB [Pseudomonas fluorescens F113]
MAKEGSIAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTHRRDERKIEDRKPIGIDKMTFDEVLAKQE
LNLILSVPNRLQEESETEELAVQLRVNSMKDFNPASLVEQVPELSKLMELRDALMALKGPLGNAPAFRKA
IEGVLGNDDSRRRVLDELGLNTTAKNA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6725365-6724862 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGCCAAAGAAGGCTCGATCGCCCCCAAGGAACGCATCAACGTCACCTTCAAACCTGCCACCGGCGGTG
CCCAGGAAGAAATTGAACTGCCGTTGAAACTATTGGCGATCGGTGATTACACCCACCGCAGGGATGAACG
CAAGATCGAGGACCGCAAGCCGATTGGCATCGACAAGATGACCTTCGACGAGGTGTTGGCCAAGCAAGAG
CTGAACCTGATCTTGAGCGTACCGAATCGTCTCCAGGAAGAAAGCGAAACTGAAGAGCTGGCAGTACAGC
TGCGTGTGAACTCGATGAAGGATTTCAACCCGGCTAGCCTGGTCGAGCAAGTGCCGGAGCTCAGCAAACT
GATGGAGTTGCGCGACGCCCTGATGGCGCTCAAAGGGCCATTGGGTAACGCGCCGGCGTTTCGCAAGGCC
ATCGAAGGCGTACTCGGCAATGACGATTCCCGCCGCCGCGTACTGGATGAGCTGGGCCTGAACACCACAG
CTAAGAACGCTTGA