SecReT6
Protein ID: 378953710
SecReT6 ID541
T6SS typei1
Gene symbolimpA3
Locus tagPSF113_5829
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6725398..6726954 [-]
Productprotein ImpA
NoteTssA
UniProt IDG8Q818
KEGG IDpfe:PSF113_5829
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-22, Aligned region: 55..114
Protein Sequence: 518 a.a.     [Download]
>gi|378953710|ref|YP_005211198.1| protein ImpA [Pseudomonas fluorescens F113]
MSYSGKLSAHYLALAKTPISKEGFAGADVRFSNEYEALESELGKAQSMHESGQVDWLKIREGSEALLRTQ
SKDLRVAAWLVWALYQRESLQGLLAGLCLLHHLCKNHWPDIHPIKNRTRAASINWLVPRLEQALGDDVAI
KEQLPLFRHLTEQLEGLDTACTAHLGDDAPLLLPLCRRLNTMIQRATDNLPQAGAIGTVVAQVKQVATQL
LTPGAPIENEKEAHKALRAQQESAGPLCIWWLKQKATDVRALRLNRTLTWLAIDAMPERNAEQITQLRGL
PADKLKAYQDSLHQGDYANLLVEIEASLAKAPFWLDGQRLAWECLQGLNAELAMGEVEVHFALFIQRLPG
VIELRWHDGTPFADPATRAWIASQVMPHLQNPGTAPEIDTTHNDAPWELTLEEAQSILSKDGLKPAVQLL
RQGMQNALGARECFLWRFAMARLCFSARKYELAKVQLEVLDQTLQHAGLNTWEPTLELQVLHLLHSCCEL
LPQNHVIRECKEETYRRLCHLDLERVIE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6726954-6725398 Pseudomonas fluorescens F113 chromosome, complete genome
ATGTCGTATTCCGGAAAACTGTCCGCCCATTACCTGGCTCTCGCCAAAACGCCCATCTCCAAAGAGGGTT
TTGCGGGTGCGGACGTGCGTTTTTCGAATGAATACGAGGCGTTGGAAAGCGAGCTGGGCAAAGCCCAGTC
GATGCACGAAAGCGGCCAGGTCGACTGGCTGAAGATCCGTGAAGGAAGTGAAGCGCTGTTGCGTACCCAG
TCGAAGGACTTGCGAGTGGCGGCCTGGCTGGTTTGGGCGCTGTATCAGCGTGAATCTCTCCAAGGGCTGC
TGGCCGGCCTCTGTCTTTTGCACCACTTGTGTAAAAACCATTGGCCTGACATTCATCCGATCAAAAATCG
AACCCGTGCCGCCAGCATCAATTGGTTGGTGCCTCGCCTGGAGCAGGCGTTGGGCGATGACGTTGCGATC
AAGGAGCAGTTGCCGCTGTTCCGCCATCTGACAGAACAACTTGAAGGTCTCGATACCGCCTGCACCGCCC
ACTTGGGTGATGATGCGCCTCTGCTGCTCCCGTTGTGTCGGCGCCTCAACACGATGATCCAGCGTGCCAC
AGACAACCTGCCGCAGGCGGGTGCCATTGGGACGGTAGTGGCTCAGGTGAAGCAAGTTGCCACCCAACTG
CTCACGCCCGGCGCTCCGATCGAAAACGAAAAAGAAGCTCACAAGGCTCTGCGTGCCCAGCAGGAAAGCG
CAGGGCCGTTATGCATCTGGTGGCTCAAGCAAAAAGCAACCGACGTTCGGGCCCTGCGCCTGAATCGTAC
GTTGACCTGGCTGGCCATTGACGCCATGCCCGAGCGCAACGCCGAGCAGATCACGCAGTTGCGGGGACTG
CCGGCGGACAAACTCAAGGCTTATCAGGACAGTCTCCACCAAGGCGATTACGCGAACCTGCTGGTGGAGA
TCGAGGCCAGCCTGGCGAAGGCTCCGTTCTGGCTCGATGGCCAGCGGCTTGCCTGGGAGTGCCTGCAAGG
GTTGAACGCCGAGTTGGCCATGGGTGAAGTGGAGGTCCATTTCGCGCTATTCATCCAGCGCCTGCCAGGG
GTTATCGAATTGCGCTGGCATGACGGTACGCCGTTCGCCGATCCCGCCACGCGGGCGTGGATCGCGTCCC
AGGTTATGCCTCATCTGCAAAACCCCGGCACGGCACCCGAAATCGATACCACCCACAACGATGCGCCTTG
GGAACTGACGCTGGAAGAGGCCCAGTCGATCCTGTCCAAGGATGGCCTCAAACCCGCCGTCCAGTTACTC
AGGCAAGGCATGCAAAACGCTCTTGGGGCACGCGAGTGTTTCCTCTGGCGGTTCGCGATGGCTCGCTTGT
GCTTCTCGGCGAGGAAATACGAACTCGCGAAAGTCCAACTCGAGGTCCTCGACCAGACACTGCAACACGC
CGGCCTGAATACCTGGGAGCCCACCCTGGAGTTACAGGTACTGCATTTGTTGCACAGCTGCTGCGAGTTA
TTGCCTCAGAACCACGTCATACGCGAGTGCAAGGAAGAGACCTATCGCAGGTTGTGTCACCTCGACCTGG
AACGGGTCATTGAATAG