SecReT6
Protein ID: 378953711
SecReT6 ID541
T6SS typei1
Gene symbolvgrG2a
Locus tagPSF113_5830
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6727385..6729448 [+]
Productprotein VgrG2a
NoteTssI
UniProt IDG8Q819
KEGG IDpfe:PSF113_5830
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-68, Aligned region: 30..326
Phage_GPD [PF05954], Evalue: 1.10E-68, Aligned region: 339..370
Phage_GPD [PF05954], Evalue: 1.10E-68, Aligned region: 526..552
Phage_base_V [PF04717], Evalue: 2.50E-23, Aligned region: 375..467
Protein Sequence: 687 a.a.     [Download]
>gi|378953711|ref|YP_005211199.1| protein VgrG2a [Pseudomonas fluorescens F113]
MFHTPDLRKIHLTIPDLEHDLKVLAFEGCEAISTPYSFDIELVSEQSDMDLEYLLNQQAFLAFNKQGSGV
HGLIYRVVQGDTGKRLTHYKIRLVPRLTYLEHRTNQRIFQHVSVPQIITSVLKEHGILTDAHCFQLSASY
SPRDYCVQYRESDLHFIERLCHEEGLHYHFQHSESGHHLVFGDDQTVFPRLEHRTAYKHGSGMVDDEPVI
HRFGLRLETRTSRVTRRDYDFKKSTFPLESSCQPGVEKIQPDLEAYDYPGDFTQEKRGRLLSRRALERHR
VDYRQAEGKSDQPALTTGHFLTLSGHPRQEWNDLWLLTEVHHEGKQPQVLEEITPSDTGRAEEHFNQGYR
NHFVATPWDAIFRSQRVYQKPRVWGSQTAIVTGPKGEEIHCDPYGRVKVRFFWDRAGHLDDGSSCWLRVA
SNWAGNSYGGVTIPRVGMEVLVTFMEGDPDKPLISGCLTNSANARPYPLPAHKTRTVFRSCSSPGNNGFN
ELHLEDRAGQELIYLRAQRDMEQKIENDSRLEIGNERRETIRGNSITVLHAEEHRTTAADRTVQIEGNDY
LRVANRHTRVDQTLAVEAGQQIQIKAGAHVVLEAGASLSLKAGGQHILINHSGIYSSSEIQLGGAPMAGA
TASSFTPGLTDPLAAPAPVLAPTQRALITASKVAGLDFCPICEACREGLCPMEVAAA
 
Nucleotide Sequence: 2064 bp     [Download]
>gi|378947941|ref|NC_016830.1|:6727385-6729448 Pseudomonas fluorescens F113 chromosome, complete genome
ATGTTCCACACCCCTGACTTGCGCAAAATTCATCTCACAATTCCTGACCTCGAACATGACCTCAAAGTGT
TGGCCTTCGAAGGCTGCGAAGCCATTAGCACACCTTATTCGTTTGATATCGAGCTCGTCAGCGAACAAAG
CGATATGGATTTGGAATACTTGTTAAACCAGCAGGCATTTCTTGCATTCAACAAACAGGGAAGCGGTGTT
CACGGGCTGATTTATCGTGTTGTACAAGGCGACACTGGCAAACGCTTGACGCATTACAAGATAAGACTGG
TTCCACGATTGACTTACTTGGAACACCGCACCAACCAGCGTATTTTTCAACACGTCAGTGTTCCGCAGAT
CATTACATCGGTCCTCAAGGAGCACGGTATTCTCACTGACGCCCATTGCTTCCAGTTGAGTGCAAGTTAT
TCGCCTCGTGACTACTGCGTGCAGTATCGCGAATCCGACTTGCACTTCATCGAGCGCCTGTGTCACGAAG
AAGGCCTGCATTATCACTTCCAGCACAGTGAGTCGGGCCATCACTTGGTATTTGGTGATGACCAGACTGT
ATTCCCCCGGCTTGAGCACCGCACTGCTTATAAACACGGCAGCGGCATGGTTGACGACGAGCCGGTTATC
CATCGATTTGGCCTGCGACTGGAGACCCGGACCAGCCGCGTCACGCGCCGTGATTACGATTTCAAGAAGT
CGACATTCCCACTGGAGAGCAGCTGCCAGCCCGGCGTCGAAAAGATCCAACCAGACTTGGAGGCCTATGA
TTATCCAGGCGACTTTACCCAGGAAAAACGCGGCAGGTTATTGAGCCGGCGAGCCCTGGAACGTCATCGT
GTCGACTACCGCCAGGCCGAAGGAAAGAGTGATCAGCCGGCACTGACGACGGGGCACTTCCTGACATTGA
GCGGGCACCCTCGTCAGGAATGGAATGATCTATGGCTCCTGACCGAAGTGCATCACGAAGGCAAACAGCC
GCAGGTACTGGAGGAAATCACCCCCAGCGACACTGGCAGGGCTGAAGAGCACTTCAATCAGGGCTATCGC
AATCACTTCGTTGCCACGCCTTGGGATGCGATCTTTCGTTCGCAACGGGTTTACCAAAAACCACGTGTAT
GGGGCAGCCAGACGGCAATCGTCACGGGGCCCAAGGGCGAAGAGATCCACTGCGACCCGTATGGCCGGGT
CAAGGTCAGGTTTTTCTGGGATCGTGCGGGGCACCTCGACGACGGCAGCAGCTGTTGGTTGCGAGTCGCC
TCCAATTGGGCGGGCAACAGCTACGGGGGCGTCACGATCCCGCGGGTGGGCATGGAGGTGTTGGTGACCT
TCATGGAAGGCGATCCCGACAAGCCCCTGATCAGCGGATGTCTGACCAACAGCGCCAACGCTCGGCCCTA
CCCGCTGCCTGCGCACAAGACCCGCACCGTGTTTCGTTCTTGCAGCTCGCCGGGCAACAACGGCTTCAAC
GAGCTGCACCTGGAAGACCGCGCCGGTCAGGAGCTGATCTATCTGCGGGCCCAGCGTGACATGGAACAGA
AGATCGAAAACGACAGCCGACTTGAGATTGGCAACGAGCGGCGGGAGACCATCAGGGGCAACAGCATCAC
CGTTCTGCACGCCGAGGAACATCGGACCACCGCCGCCGACCGTACGGTCCAGATCGAAGGCAATGACTAC
CTGCGCGTCGCCAACCGCCATACCCGTGTCGATCAGACACTGGCCGTCGAGGCCGGGCAGCAAATACAGA
TCAAGGCTGGCGCTCATGTGGTCCTTGAAGCAGGTGCATCTCTCAGTTTGAAAGCCGGGGGCCAGCACAT
CCTGATCAACCACAGCGGTATCTACAGCAGCAGTGAAATCCAGCTCGGCGGCGCCCCCATGGCCGGCGCT
ACCGCTTCATCATTCACGCCTGGCTTGACCGATCCCTTGGCGGCTCCAGCCCCCGTGCTCGCCCCCACTC
AACGCGCGCTGATAACGGCCAGCAAAGTAGCGGGATTGGACTTTTGTCCGATTTGCGAGGCCTGCCGCGA
GGGTCTCTGCCCAATGGAAGTCGCCGCCGCATGA