SecReT6
Protein ID: 378955572
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1900
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1887460..1889571 [-]
ProductRHS-family protein
NoteTssI
UniProt IDG7T6T9
KEGG IDsel:SPUL_1900
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.40E-65, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 3.50E-26, Aligned region: 365..457
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 499..521
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 523..545
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 539..561
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 574..578
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 607..623
Protein Sequence: 703 a.a.     [Download]
>gi|378955572|ref|YP_005213059.1| RHS-family protein [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MSTGLRFTLEVDGLPPDALVVESFHLSQSLSTLFSLDISLVSQQLHNIEFAQVLEKPAHLKIWQGTEIQR
RVNGIVTWFEQGENDGHQMLYSMKVRPPVWRAALRQNSRIFQNEDIKSILGTILQENGVTDWSPLFSEAH
PAREFCVQYSETDYDFLARMAAEEGIFFYEEHAQTSDDQSLVLCDTVRFLPEAFEIPWNPNTRTEVSTPC
VSQFRHSAQIRPSSVIGKDYTFKRPGWAGRFEHQGEHQDYQRTQYEVFDYPGRFKDGHGQNFARWQMEGW
RNNAEVAQGKSRSPAIWPGRRIQLTEHPQASLNREWQVVSSDLHGSQPQAAGRSGSGTTLDNHFTVIPAD
RTWRPRPLPKPSVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPANQDSSCWIRVVQAWAGPGFGN
LAIPRVGQEVIVDFLNGDPDQPIIMGHTYHQENRSPGSLPGTKTQMTIRSKTYKGSGFNELMFDDATGKE
RVYIHAQKNMNTEVLHNRTTDVTNNHAETIGNNQVIAVTNNQIQTIGVNQVEKVGSNQVIKVGANQVETV
GIVRALNVGLAYQTTVGGIMNTSVALMQSSEVGIFKSLNVGMKYNVNVGRNASVNVGNSKTESTGKTAVY
SAGEHLELVCGEARLVLTSDGGIFLNGKHIELQGVDSLNGDSKLISWNCGVSKKPPEASEQQDDPDPSDL
IMY
 
Nucleotide Sequence: 2112 bp     [Download]
>gi|378953804|ref|NC_016831.1|:c1889571-1887460 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGTCAACAGGATTACGTTTCACACTGGAGGTGGACGGCCTGCCACCGGATGCGCTGGTCGTGGAGTCCT
TTCACCTGAGCCAGTCCCTTTCCACGTTATTTTCCCTCGATATCTCGCTGGTCAGTCAGCAACTTCACAA
CATTGAGTTTGCCCAGGTACTGGAAAAACCGGCGCACCTGAAAATCTGGCAGGGCACGGAGATACAGCGC
CGGGTGAACGGCATAGTGACCTGGTTTGAGCAGGGGGAAAACGACGGACACCAGATGCTGTACAGCATGA
AAGTTCGTCCGCCGGTGTGGCGCGCCGCGCTGCGGCAGAACTCGCGTATTTTCCAGAATGAAGACATAAA
AAGCATTCTCGGGACGATACTGCAGGAAAACGGCGTGACGGACTGGAGCCCGCTGTTCAGTGAGGCGCAT
CCGGCGCGGGAGTTCTGCGTGCAGTACAGCGAAACGGATTACGACTTTCTGGCGCGGATGGCGGCGGAGG
AAGGTATTTTCTTTTACGAGGAACATGCGCAGACCAGCGACGACCAGAGCTTGGTGCTGTGCGACACGGT
ACGTTTTCTGCCGGAAGCCTTTGAAATCCCCTGGAACCCGAACACCCGTACCGAGGTGAGCACGCCGTGC
GTCAGCCAGTTCCGCCACAGCGCGCAAATCCGCCCCTCTTCCGTCATCGGCAAGGACTACACCTTCAAAC
GCCCCGGCTGGGCGGGCCGCTTTGAGCACCAGGGCGAACATCAGGATTACCAGCGCACGCAGTATGAGGT
CTTTGATTATCCGGGGCGCTTCAAGGACGGCCACGGTCAGAACTTCGCCCGCTGGCAGATGGAAGGCTGG
CGTAATAATGCCGAAGTGGCGCAGGGGAAAAGCCGTTCGCCGGCGATATGGCCGGGACGGCGTATTCAGC
TGACGGAACACCCGCAGGCGAGCCTGAACCGGGAATGGCAGGTGGTGAGCAGCGATTTACACGGCAGCCA
GCCGCAGGCGGCGGGGCGCTCAGGTTCAGGGACAACGCTGGACAATCATTTTACGGTCATCCCGGCAGAC
AGAACATGGCGGCCACGCCCGCTGCCCAAACCATCAGTGGACGGCCCGCAGTCGGCGGTGGTCACCGGCC
CGGAAGGGGAAGAAATCTTCTGCGACGAACATGGCCGTGTACGGGTGAAATTTAACTGGGACCGGTATAA
CCCGGCGAACCAGGACAGCTCGTGCTGGATACGGGTGGTACAGGCGTGGGCGGGGCCGGGGTTCGGCAAC
CTGGCGATACCGCGCGTGGGGCAGGAAGTGATAGTGGACTTCCTCAACGGCGACCCGGACCAGCCCATCA
TCATGGGGCACACCTACCACCAGGAAAACCGCTCACCGGGCAGCCTGCCGGGCACCAAAACGCAGATGAC
CATCCGCTCGAAAACCTATAAAGGCAGCGGGTTTAACGAACTCATGTTTGATGATGCGACAGGGAAGGAG
CGCGTGTATATCCACGCGCAGAAGAATATGAATACCGAGGTGCTGCACAACCGCACCACCGATGTGACGA
ATAATCATGCTGAAACCATTGGTAATAACCAGGTGATTGCCGTTACCAATAACCAAATCCAGACCATCGG
CGTCAACCAGGTGGAGAAGGTGGGCAGTAACCAGGTGATCAAGGTGGGTGCCAATCAGGTGGAAACGGTG
GGGATTGTCCGCGCCCTGAATGTGGGGCTGGCATACCAGACTACCGTGGGCGGCATCATGAATACCTCGG
TGGCGCTGATGCAGTCTTCTGAGGTCGGGATCTTCAAATCACTGAATGTGGGAATGAAATACAACGTCAA
TGTCGGGCGTAATGCCAGCGTTAACGTGGGCAACAGTAAAACCGAAAGTACCGGTAAAACGGCGGTGTAT
TCCGCAGGCGAGCATCTGGAGCTGGTGTGTGGTGAAGCCCGTCTGGTGCTGACGAGCGACGGCGGTATTT
TTCTGAACGGCAAACATATTGAGTTGCAGGGCGTGGACAGCTTAAACGGGGATTCAAAGCTGATCAGCTG
GAACTGTGGGGTGAGCAAGAAGCCACCTGAAGCATCTGAACAGCAGGATGACCCCGATCCATCGGATCTG
ATCATGTACTGA