SecReT6
Protein ID: 378955573
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1901
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1889793..1890197 [-]
Producthypothetical protein
NoteTssD
UniProt IDG7T6U0
KEGG IDsel:SPUL_1901
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-29, Aligned region: 2..117
DCAF15_WD40 [PF14939], Evalue: 0.0026, Aligned region: 55..98
Protein Sequence: 134 a.a.     [Download]
>gi|378955573|ref|YP_005213060.1| hypothetical protein SPUL_1901, partial [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MLVQEFLHNVTVPTDPQSGQPSGQRSHKPFIFTVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQE
HYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 405 bp     [Download]
>gi|378953804|ref|NC_016831.1|:c1890197-1889793 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGCTGGTACAGGAATTCCTGCATAACGTGACCGTACCCACTGATCCACAGTCCGGGCAGCCGAGCGGCC
AGCGTTCGCACAAGCCGTTCATTTTTACCGTGGCGCTGAACAAAGCCGTACCGCTGCTGTACAACGCGCT
GGCGTCCGGTGAAATGCTGCCGAAAACCGAACTGCACTGGTGGCGTACTTCCGTTGAAGGCAAGCAGGAG
CATTACTTCACCACCCGCCTGACGGACTCAACGATTGTGGATATGAAACTGCATATGCCGCACTGTCAGG
ACCCGGCAAAGCGCGAATTCACGCAGTTGCTCGAAGTCTCGCTGGCCTACCGCAAAATCGAGTGGGAACA
CGTCAAATCCGGCACCTCTGGCGCGGATGACTGGCGCGCGCCGCTGGAAGCGTAA