SecReT6
Protein ID: 378955575
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1903
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1890940..1891443 [+]
Producthypothetical protein
NoteTssB
UniProt IDG7T6U2
KEGG IDsel:SPUL_1903
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.90E-54, Aligned region: 7..163
Protein Sequence: 167 a.a.     [Download]
>gi|378955575|ref|YP_005213062.1| hypothetical protein SPUL_1903 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MSKDYNGSVAPKERINISYIPKTDGEPSEVELPLNMLIVGDTGNSQETAPLDERQMVSIDKHSFNSVMAE
ASISLNFAVPASLKDDAKDGDEMNISLEIKSLNDFSPDSVAKQVPELNKLLELREALTALKGPLGNLPAF
RAQLQALLENEESREQLLREISQAENQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1890940-1891443 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGAGCAAAGATTATAACGGCAGCGTGGCACCCAAAGAACGCATTAATATTTCTTACATTCCAAAAACGG
ACGGTGAGCCTTCTGAGGTGGAATTACCCCTTAATATGTTGATAGTGGGGGATACCGGAAACTCACAGGA
AACAGCGCCACTTGATGAACGCCAGATGGTTTCTATCGACAAACATTCATTCAATTCAGTGATGGCAGAA
GCGTCCATTAGCCTGAATTTTGCAGTTCCGGCATCATTGAAGGACGACGCAAAAGATGGCGATGAGATGA
ATATCTCGCTGGAAATCAAATCCCTGAACGATTTTTCTCCGGACAGCGTGGCAAAACAGGTACCGGAGTT
GAACAAATTGCTGGAACTACGCGAAGCGCTGACAGCATTAAAAGGCCCGCTCGGTAATCTGCCTGCATTT
CGCGCCCAGCTTCAGGCATTGCTGGAAAATGAAGAATCCCGCGAACAGTTACTGCGGGAGATCAGCCAGG
CAGAAAACCAGTAA