SecReT6
Protein ID: 378955576
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1904
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1891473..1891685 [+]
Producthypothetical protein
NoteTssC
UniProt IDG7T6U3
KEGG IDsel:SPUL_1904
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.002, Aligned region: 36..68
Protein Sequence: 70 a.a.     [Download]
>gi|378955576|ref|YP_005213063.1| hypothetical protein SPUL_1904 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MGLREETSRTDDAITQAVIRLFISQTGDINTETLEVLVAALDQRIGCLMDEIIHINGYQQMKPHWRKVFH
 
Nucleotide Sequence: 213 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1891473-1891685 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGGGCTTGCGGGAAGAGACCTCCAGAACCGATGACGCAATAACGCAGGCAGTGATCCGGTTATTTATCA
GTCAGACAGGCGACATCAACACAGAAACACTGGAGGTATTGGTCGCGGCGCTTGACCAGAGGATCGGATG
TCTGATGGATGAAATCATCCATATCAACGGGTACCAGCAGATGAAGCCACACTGGCGAAAGGTGTTCCAC
TGA