SecReT6
Protein ID: 378955578
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1906
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1893203..1893619 [+]
Producthypothetical protein
NoteTssE
UniProt IDG7T6U5
KEGG IDsel:SPUL_1906
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-15, Aligned region: 32..115
Protein Sequence: 138 a.a.     [Download]
>gi|378955578|ref|YP_005213065.1| hypothetical protein SPUL_1906 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MIPAREKPAGSLFERLENPPARNWREGSNIEAFRQSIRHSLRNILNTRSGSCRGTPGLGIEEPEGSDNYR
SAMSQAIVQCIERYEPRISHAEVRAILPQAASPQEIIFRITAWVTFNDIDDVLEFDMAPDGSQHYRVE
 
Nucleotide Sequence: 417 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1893203-1893619 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
GTGATACCGGCGCGCGAAAAGCCTGCCGGATCGCTGTTTGAGCGTCTGGAAAACCCTCCTGCCAGAAACT
GGCGGGAGGGCAGTAATATAGAGGCGTTCAGGCAGTCCATTCGCCATAGTCTGCGCAATATCCTGAACAC
CCGCTCCGGCAGTTGTCGGGGAACACCGGGGCTGGGTATTGAAGAGCCGGAAGGGTCGGATAATTACCGC
AGCGCCATGAGCCAGGCCATCGTGCAGTGTATTGAGCGTTATGAACCCCGGATTTCGCACGCGGAGGTCC
GGGCAATCCTGCCACAGGCCGCCAGCCCACAGGAGATAATTTTTCGTATCACCGCCTGGGTGACATTTAA
CGATATCGACGATGTGCTGGAGTTTGATATGGCACCGGACGGTAGTCAGCATTATCGGGTGGAGTAG