SecReT6
Protein ID: 378955580
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1908
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1895441..1896529 [+]
Producthypothetical protein
NoteTssG
UniProt IDG7T7Q7
KEGG IDsel:SPUL_1908
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-88, Aligned region: 34..349
Protein Sequence: 362 a.a.     [Download]
>gi|378955580|ref|YP_005213067.1| hypothetical protein SPUL_1908 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MGGKNRATPAHLSPDDAPAQDEQRTLREPLFQDACACNFFALSELLHRLASEGGETPVLSLDTPPAQETI
RFQADASLGFPVSDVSALEQDASGLFRMTTTFMGLQGSQSPLPGYYLDHLAWKSAHEQSPVSDFLDMFSH
RLTQFVWHIWRKYRYHVAFRNGGVDAFSQRMYSLVGLGHRQLRDSLPVNHSKMLAYAGILANPGRSPEIV
CTLVAHCFDLNLSDVTLQNWQRRMVDIEPDQQNSLGCYTIKNGEKLAGRSVLGNFVLGTRVPDLSGKFQL
SINHLSRKQFLSFLPSGENFLPLAMFVSFVLRDQLAWDLHLGLAPDQVGIMRLGDNKSALLGWTSFLGEP
GEHPSVTIRVRE
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1895441-1896529 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGGGCGGAAAGAACCGGGCAACACCCGCTCATCTGAGTCCGGACGATGCTCCGGCGCAGGATGAACAAC
GCACGCTGCGGGAGCCGTTGTTTCAGGACGCCTGCGCCTGCAATTTTTTCGCGCTCTCTGAGCTGCTGCA
CCGGCTGGCATCAGAAGGCGGCGAAACGCCAGTGTTATCCCTGGATACCCCTCCGGCGCAGGAAACCATT
CGTTTCCAGGCGGACGCCAGCCTGGGATTTCCGGTAAGCGATGTCAGCGCGCTGGAGCAGGATGCTTCCG
GGTTGTTCCGGATGACCACCACCTTTATGGGATTGCAGGGCAGCCAGTCGCCCCTCCCCGGCTATTACCT
TGATCACCTGGCCTGGAAATCCGCGCACGAGCAGAGTCCGGTCAGCGATTTTCTGGATATGTTCAGCCAT
CGCCTGACGCAGTTTGTCTGGCATATCTGGCGTAAGTACCGTTACCACGTCGCTTTCCGTAACGGCGGCG
TGGATGCGTTCTCGCAGCGGATGTACTCCCTGGTGGGGCTGGGCCACCGGCAGCTTCGCGACAGTCTGCC
CGTTAACCACAGCAAAATGCTGGCCTATGCCGGGATACTGGCAAATCCGGGACGTTCGCCGGAGATCGTC
TGTACGCTGGTTGCGCACTGTTTCGATTTAAATTTATCGGACGTGACGCTGCAAAACTGGCAGCGGCGGA
TGGTGGATATCGAGCCGGATCAGCAGAACAGTCTTGGATGTTACACGATTAAAAATGGCGAAAAACTGGC
CGGGCGATCGGTGCTGGGTAATTTTGTCCTCGGTACGCGGGTTCCCGATCTCAGCGGTAAATTTCAGTTA
AGTATTAACCACCTGAGCCGCAAGCAGTTTCTCTCGTTCCTGCCGTCAGGAGAAAATTTTCTGCCGCTGG
CGATGTTTGTCTCCTTCGTCCTGCGCGATCAGCTTGCCTGGGATTTACACCTGGGGCTGGCCCCGGATCA
GGTGGGGATTATGCGGCTGGGCGATAACAAGAGCGCGCTGCTGGGCTGGACGTCATTTCTCGGCGAGCCG
GGAGAGCATCCCTCAGTCACCATCAGGGTCAGGGAGTAA