SecReT6
Protein ID: 378955581
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1909
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1896554..1897840 [+]
Producthypothetical protein
NoteFha
UniProt IDG7T7Q8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 428 a.a.     [Download]
>gi|378955581|ref|YP_005213068.1| hypothetical protein SPUL_1909 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MAEEKARQQTLSLHVVNGNELESGRTARCLFTGDGDVGHGSECHWPVQDRHQNVPAKAFSISLHDGAFCL
HPLASPLWLNQAKVTAASDQVQLRQGDEIQTGHLILRVYLNQGGMRHYDEEMATPETIVSNHDLLSDTLL
STDGAPEYPGMPSRHQLADTVVNGFSTDPLQVLQAESLTTRDNPLAGITPARPSAPLSDPAINGGINTPF
MDLPSMYADPHDNEEGMSPADAAQRHLAVTPLLRGLGGSLAVHNTQDADDFLEEAGRTLQAAIQGLLELQ
QRRNSLSDKHLRPLEDNPLRLNMDYATALDVLFAEGKSPVHLAAPAAVSESLRNIRHHEEANRAAIVESL
RVLLDAFSPQSLMRRFVQYRRSHELRKPLDDAGAWQMYCDYYDELASSRQQGFEMLFNEVYAQVYDRVLR
EKQREPEA
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1896554-1897840 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGGCGGAAGAAAAAGCGCGGCAACAGACGCTTTCACTGCATGTCGTTAACGGTAACGAGCTGGAGAGCG
GACGTACCGCACGGTGTCTGTTCACCGGAGACGGCGATGTGGGCCACGGCAGCGAATGCCACTGGCCTGT
TCAGGACCGGCACCAGAACGTTCCGGCGAAGGCGTTCAGCATCAGCCTGCATGATGGCGCATTCTGCCTG
CATCCGCTGGCATCGCCATTATGGCTGAACCAGGCTAAAGTCACGGCGGCCTCAGACCAGGTGCAGTTAC
GTCAGGGCGATGAGATCCAGACCGGGCATCTGATACTCCGGGTTTATCTGAACCAGGGCGGGATGCGGCA
TTACGATGAGGAGATGGCGACGCCTGAAACCATCGTTTCTAACCACGACCTCCTGTCGGACACGCTACTG
TCCACGGACGGCGCGCCGGAATATCCGGGAATGCCGTCCCGCCATCAGCTCGCGGATACCGTTGTTAATG
GCTTTTCCACCGATCCGTTGCAGGTGCTCCAGGCTGAAAGTCTGACCACCAGGGACAATCCGCTTGCGGG
TATCACCCCGGCCCGGCCCTCCGCCCCGTTATCCGATCCGGCGATAAACGGCGGGATCAACACGCCGTTT
ATGGATCTGCCGTCCATGTATGCCGATCCGCATGATAATGAAGAGGGCATGTCACCGGCAGACGCGGCGC
AGCGCCACCTCGCCGTCACGCCGTTACTGCGCGGGCTGGGGGGATCGCTTGCCGTGCATAACACCCAGGA
CGCCGATGATTTTCTGGAGGAGGCCGGAAGGACATTGCAGGCGGCGATTCAGGGGTTGCTTGAGCTACAG
CAGCGCCGCAACAGCCTGTCAGACAAGCATCTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAATATGG
ACTACGCCACGGCGCTGGACGTGCTGTTTGCCGAAGGGAAAAGCCCGGTACATCTGGCCGCGCCCGCCGC
CGTCAGCGAGAGCCTGCGCAATATTCGTCATCACGAAGAAGCCAACCGCGCCGCGATTGTGGAATCGCTG
CGCGTGCTGCTGGACGCCTTCTCGCCACAGAGTCTGATGCGCCGTTTTGTGCAGTACCGCCGCAGCCACG
AACTGCGTAAACCGCTGGATGATGCCGGTGCGTGGCAGATGTACTGCGATTATTACGATGAGCTGGCCTC
CAGCCGCCAGCAGGGTTTTGAGATGCTGTTTAACGAAGTGTATGCCCAGGTGTATGACCGGGTGTTGCGT
GAAAAGCAGCGGGAGCCGGAAGCATGA