SecReT6
Protein ID: 378955582
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1910
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1897837..1898370 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDG7T7Q9
KEGG IDsel:SPUL_1910
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.90E-33, Aligned region: 17..170
Protein Sequence: 177 a.a.     [Download]
>gi|378955582|ref|YP_005213069.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MTGRGFLAWAMVALFTLALCGCETVKKIGEVIKNPDIQVGKLADQSSQVTITLLTEPDANINADGEAAAV
DVQLVYLSDDSKFQAADYDQIATTALPDALGKNYIDHQDFSLLPDTMKTLPPVKLDEKTQFIGVIAYFSD
DQTTEWKQIEPVEGTGHNYRLLVHIRQSSIEMKKEDD
 
Nucleotide Sequence: 534 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1897837-1898370 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGACAGGCCGTGGTTTCCTCGCCTGGGCGATGGTGGCGTTGTTCACCCTCGCCTTATGCGGTTGTGAAA
CGGTAAAAAAAATCGGCGAGGTGATTAAAAACCCGGATATTCAGGTCGGTAAGCTGGCAGACCAGTCTTC
GCAGGTGACGATTACGCTGCTGACGGAGCCGGATGCCAATATCAACGCGGACGGTGAAGCGGCTGCGGTG
GACGTGCAGCTGGTTTATCTGAGCGATGACTCAAAATTTCAGGCGGCCGACTACGACCAGATAGCCACCA
CCGCACTACCCGACGCGCTGGGGAAAAACTATATCGATCACCAGGATTTCAGCCTGCTGCCCGACACCAT
GAAAACCCTGCCGCCGGTGAAGCTGGATGAGAAAACGCAGTTTATCGGCGTGATTGCCTATTTTTCCGAC
GACCAGACTACGGAATGGAAGCAAATCGAACCGGTAGAAGGGACAGGACACAACTACCGCCTGCTGGTGC
ATATCCGGCAGAGCAGTATTGAAATGAAAAAAGAGGATGATTAA