SecReT6
Protein ID: 378955583
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1911
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1898373..1899704 [+]
Producthypothetical protein
NoteTssK
UniProt IDG7T7R0
KEGG IDsel:SPUL_1911
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-147, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|378955583|ref|YP_005213070.1| hypothetical protein SPUL_1911 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MATTRNKVMWREGTLMRPHHLQQQQRYNDYVNNLRFRAIHDLSWGFTELSLNDELLGQGKIMIDSASGTL
PDGTVFSLPDQDALPDPLHPDSFPDEESRNVYLALPVASDVRGEVSYGQQVGRYRLSDASVRDLHSENGD
ARTLTLGQLTPRIMSGADDMSAYVTLPLCRIKDRRADGSLMLDENFIPTCQNVYVSARLREFLREVQEAV
GGRANDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRPHLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHRNLTDTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSRLLQSATFVLAVAA
KMETLQLQRQFIQQSKISSPEKIRNMVSVQIPGIPLHTLMVAPRQLPYHAGFSYFELDKSGAAWADVAAT
GAVALHVSGTFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1898373-1899704 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGGCAACCACGCGAAACAAGGTGATGTGGCGGGAAGGAACGCTGATGCGTCCGCACCATCTCCAGCAGC
AACAACGTTATAACGATTATGTGAATAATCTGCGTTTCCGGGCCATTCATGATTTGTCCTGGGGATTTAC
CGAGCTTTCCCTCAATGATGAGCTGCTGGGACAGGGCAAAATTATGATCGACAGCGCGTCGGGCACCCTG
CCGGACGGCACCGTGTTTTCCCTTCCGGACCAGGATGCGCTCCCCGATCCGCTGCATCCGGACAGTTTTC
CTGATGAAGAAAGCCGCAATGTCTATCTGGCTTTACCCGTTGCCAGCGATGTGAGAGGCGAAGTCAGTTA
CGGGCAGCAGGTTGGGCGTTACCGGCTGAGCGATGCCAGTGTCCGGGATCTGCACTCCGAGAATGGCGAT
GCCCGGACGCTGACGCTGGGCCAGTTGACCCCCCGCATTATGAGCGGAGCGGACGATATGAGCGCGTATG
TCACGTTGCCGCTGTGCCGTATCAAAGACAGGCGTGCGGACGGCTCCCTGATGCTGGATGAAAACTTTAT
CCCTACCTGCCAGAACGTTTATGTCAGCGCACGGCTGCGTGAATTTCTCCGGGAAGTCCAGGAAGCGGTT
GGCGGCCGGGCCAATGACCTGGCTAACCGCATTGGCTCTCCGGCGCAAAGCGGTATTGCCGACGTTGCGG
AATTTATGATGCTGCAACTGCTCAACCGTAACCAGACGCGGTTCACCCACCGCGCCCGCAGGCCGCACCT
CCATCCGGAAGATTTTTATCTCGATCTGGCCGGACTGCTGGGCGAGCTGATGACATTTACCGAGCCATCC
CGCCTGCCCTGTCCGCTGGATGTCTACGATCACCGTAACCTGACGGACACCTTCAAAACGCTGTTGCCGG
AAGTGAAACGGGCATTACATACCGTCCTGTCGCCCAGGGCGGTTAACCTGCCGCTGCATCTGCGCGATGG
CATCTGGCAGGCTGACGTACATGACTCCAGGCTGTTGCAGTCGGCCACCTTCGTGCTGGCGGTGGCGGCG
AAAATGGAGACGCTGCAACTCCAGCGCCAGTTTATCCAGCAGTCAAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGCGTGCAAATCCCCGGCATCCCGCTGCATACGCTGATGGTGGCGCCCCGCCAGCTTCC
GTACCATGCCGGTTTCAGCTATTTCGAACTGGACAAGAGCGGGGCCGCCTGGGCGGATGTGGCGGCCACC
GGCGCTGTCGCCCTGCATGTTTCCGGTACGTTCCCGGATCTGAACATGCAACTGTGGGCCATAAGAGGAT
AA