SecReT6
Protein ID: 378955584
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1912
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1899709..1900458 [+]
Producthypothetical protein
NoteTssL
UniProt IDG7T7R1
KEGG IDsel:SPUL_1912
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-59, Aligned region: 30..231
Protein Sequence: 249 a.a.     [Download]
>gi|378955584|ref|YP_005213071.1| hypothetical protein SPUL_1912 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MDELSLPPLPGYEREGQRQYQLALRGNSLNPMIDAATPLLGMVMRVSGMNSHAMPEHLFTQVVTDVQAVE
QLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLMSEPK
RYQDLLEFLYICFSLGFRGRAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLIKRLTI
RHVLCGGIVVLALFYLFYLLRLDSQTQDILHQLNRLLAR
 
Nucleotide Sequence: 750 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1899709-1900458 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGGATGAGCTGTCACTGCCCCCTTTACCCGGATACGAGAGAGAAGGCCAGCGCCAGTATCAGCTGGCGC
TGCGCGGCAACAGCCTGAACCCGATGATCGATGCCGCCACCCCGCTGCTGGGGATGGTGATGCGCGTTTC
GGGCATGAACAGCCATGCCATGCCTGAACACCTGTTCACCCAGGTGGTGACGGATGTGCAGGCGGTGGAG
CAGTTACTCCAGGAGCAGGGCTATGAGCCTGGGGTGATTATCTCGTTTCGTTACATCCTGTGTACCTTTA
TTGACGAGGCGGCGCTGGGGAATGGCTGGTCGAACAAAAACGAGTGGATCAAGCAGTCGCTGCTGGTGCA
TTTCCATAACGAAGCCTGGGGCGGTGAAAAGGTTTTTATCCTGCTGGAGCGCCTGATGAGCGAACCCAAA
CGCTACCAGGATCTGCTGGAATTTTTGTACATCTGCTTTTCGCTGGGCTTTCGCGGGCGCGCCGTCCAGG
ACCAGGGGGAGTTTGAGCAGATATACCGCCGCCTGTATCACGTCCTGCATAAGCTGCGCGGCGATGCGCC
CTTTCCGCTGCTGCACCAGGATAAAAAAACCCAGGGCGGGCGCTATCAGCTGATTAAACGGCTGACCATC
CGGCATGTTCTGTGCGGCGGCATCGTCGTACTGGCGCTGTTTTATCTGTTTTATCTGCTGCGTCTGGACA
GTCAGACGCAGGACATTCTTCATCAGTTAAACCGGCTGCTTGCCAGGTAA