SecReT6
Protein ID: 378955587
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1915
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1903915..1905210 [+]
Producthypothetical protein
NoteTssA
UniProt IDG7T7R4
KEGG IDsel:SPUL_1915
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.40E-09, Aligned region: 13..70
Protein Sequence: 431 a.a.     [Download]
>gi|378955587|ref|YP_005213074.1| hypothetical protein SPUL_1915 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MLKLGSLAHSQLDIPEIQRRGLVILASESKDFRLLAHLLRTLQHAGDPLLALRLLALYVEHYWTVAAPQN
AAHKQRFATQVLKRFETGVESFAETARTAQRDSLLAELAKLAQRWQEQNIPALAQAVDDLSSQYRRAFRG
AAPVPPAAGPSTPPAPVSATPSAPVSPSAPAATTAPPVDIDSHDDKAWRDTLLKVAAILCERQPDSPQGY
RLRRHALWQAITSVPQAESDGRTPLAAVPADMTADYQARLNNADLALWQQVEKSLLLAPYWLDGHYLSAQ
AAQRLGYTSAAEAIRDEVVRFLARLPQLATLLFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVR
QCFSEQGLEATLRYLETLPEGDPRDRFHRQYLGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLL
EQLENKLTAEQ
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1903915-1905210 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGCTTAAACTCGGCTCGCTGGCGCACAGTCAGCTGGATATCCCGGAAATTCAGCGCCGGGGGCTGGTGA
TTCTGGCCTCGGAAAGCAAGGATTTTCGCCTGCTGGCCCATCTGCTGCGCACCCTGCAACATGCCGGCGA
TCCGCTGCTGGCGCTGCGTCTGCTGGCGCTGTACGTGGAGCATTACTGGACGGTGGCGGCACCACAAAAT
GCGGCACATAAACAGCGTTTCGCCACCCAGGTGCTGAAACGCTTTGAAACCGGCGTGGAGAGTTTCGCAG
AGACAGCCCGTACCGCGCAGCGCGACAGCCTGCTGGCTGAACTGGCGAAACTGGCGCAGCGCTGGCAGGA
GCAGAATATCCCGGCGCTGGCACAGGCCGTCGATGACCTCTCGTCGCAGTATCGCCGGGCATTTCGCGGG
GCCGCCCCGGTGCCGCCAGCGGCTGGCCCGTCCACGCCTCCGGCTCCGGTTTCGGCCACGCCGTCCGCCC
CGGTATCCCCGTCTGCGCCTGCGGCGACGACGGCGCCACCGGTGGATATCGACAGCCATGACGACAAAGC
CTGGCGCGACACGCTGCTGAAAGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGATTCACCGCAGGGCTAC
CGCCTGCGCCGCCATGCGTTATGGCAGGCCATTACATCCGTCCCCCAGGCCGAAAGCGACGGGCGCACAC
CGCTGGCGGCGGTGCCTGCCGACATGACCGCCGATTACCAGGCGCGGCTGAACAACGCCGATCTGGCGCT
CTGGCAACAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTCGATGGTCATTACCTTTCAGCGCAG
GCCGCACAACGCCTGGGCTACACCAGCGCGGCAGAAGCCATCCGGGATGAGGTGGTTCGCTTTCTCGCCC
GCCTGCCGCAACTTGCCACCCTGCTGTTTAATGACCGCACACCGTTTATCAGCGAACAGACAAAACAGTG
GCTGGCGGCGTCTCCGGGCAGTCAGACAGCCCCGATGGTGCGGACCAGTGAAGACACCGAGGCCGTCCGC
CAGTGTTTCAGCGAGCAGGGGCTGGAGGCCACGCTGCGATACCTGGAAACCCTGCCGGAAGGCGATCCGC
GCGATCGGTTCCACCGGCAGTATCTTGGCGCGCAACTGTTAGAAGAAGCCGGGATGGCGCAACTGGCACA
GCAACAGTACCGGATGTTGTTTAAAGCAGGGCTGCGCATGACGCTGGCTGAATGGGAGCCGTCCCTGCTG
GAACAACTGGAAAACAAACTCACGGCAGAACAGTAA