SecReT6
Protein ID: 378955589
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1917
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1908761..1910155 [+]
Producthypothetical protein
NoteTssA
UniProt IDG7T7R6
KEGG IDsel:SPUL_1917
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.10E-45, Aligned region: 93..156
DUF3702 [PF12486], Evalue: 2.10E-45, Aligned region: 262..271
DUF3702 [PF12486], Evalue: 2.10E-45, Aligned region: 292..438
ImpA-rel_N [PF06812], Evalue: 2.40E-21, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 2.40E-21, Aligned region: 238..265
Protein Sequence: 464 a.a.     [Download]
>gi|378955589|ref|YP_005213076.1| hypothetical protein SPUL_1917 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKLVESLALAIFKAHGVDLHTATYYTLAR
TRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNSRTGNILRQQLSFSGADLPLLYRTERA
LQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSSVDIPPQTTVRTLIYAPESTQPLTAENLPPL
PELPEMKVEVHHGAVEDPEPVARATSGRTIKGFMAGVVCAAAVAAALWWWQVYPMQQQLAQVRDTAQGAA
MLWLASPELDSYGQRLQQLPDASPLQLLEAGMQMMHTADSRWPESLQQQQATAQWNEILKTRAQSSPQMR
GWQQARQNLRDFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQYQDARAQGRNAEVLEK
QINERLDGVLSRWLLLKNNVVPETATKAPPPKIIVKSRRLTWPI
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1908761-1910155 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGAGTCAGGACGCACTCACGCACATTATTGTTACCGGCCAGGATCCGCGCGGCCTGCCGGAGTTCAGCG
CCCTGCGGGAAGAGATCAACAAATCGTCTCACCCGTCGCAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGGCCATTTTTAAAGCCCATGGCGTGGATCTGCACACGGCCACTTATTACACCCTGGCGCGC
ACCCGCACGCACGGCCTGGCCGGATTTTGCGAAGGAGTGGAGCTACTGGCGGCCATGATAAGCCACGACT
GGGACAAATTCTGGCCGCAGGATGAGTCAGCCCGCACCGGGATGCTTGACTGGCTTAATTCGCGCACCGG
CAATATTCTGCGCCAGCAGCTGTCCTTCTCCGGCGCGGACCTGCCGTTGCTGTACCGCACCGAACGGGCG
TTACAGTTGATTTGCGACAAACTCCAGCAGGTGGAACTGAAACGCCAGCCGCATGTGGAGAACCTGCTTT
ATTTTGTGCAGAACACACGTAAGCGGCTTGAGCCGCCGCCGAAAAGCAGCGTGGACATTCCGCCGCAGAC
CACCGTCAGAACGTTGATCTACGCCCCGGAGAGCACGCAGCCCCTCACGGCGGAAAACCTTCCGCCCCTG
CCTGAGTTGCCGGAAATGAAGGTGGAAGTCCACCACGGCGCGGTGGAGGATCCAGAGCCTGTCGCCAGGG
CCACGTCAGGCCGGACTATAAAAGGCTTTATGGCCGGTGTCGTCTGCGCTGCGGCTGTCGCAGCCGCACT
CTGGTGGTGGCAGGTGTACCCGATGCAACAGCAACTGGCGCAGGTAAGGGACACGGCGCAGGGCGCGGCA
ATGCTCTGGCTGGCCTCGCCTGAACTGGACAGCTACGGGCAGCGGTTACAACAGCTTCCCGACGCCTCGC
CGCTGCAACTGCTGGAGGCGGGGATGCAGATGATGCATACCGCAGACAGCCGCTGGCCGGAGAGTCTGCA
ACAGCAGCAGGCAACAGCGCAGTGGAATGAAATCCTGAAAACCCGCGCGCAAAGCAGCCCACAAATGCGC
GGCTGGCAGCAGGCGCGCCAGAATCTGCGTGACTTTGCTGACCTGATGATGCAGCGGGAAACGGAGAAGC
AGGGCTTTACCCTCTCCTATATTAAAACGGTGACCTGGCAGGCGGAACGCCTGCTGAACCAGGAAACGCC
GCTGGAGTCCCTGCTGACGCAGTACCAAGATGCCCGCGCTCAGGGACGGAATGCGGAGGTGCTGGAAAAA
CAAATTAATGAACGGCTGGATGGGGTGTTAAGCCGCTGGCTGTTGCTGAAAAACAATGTAGTGCCGGAAA
CGGCAACTAAAGCCCCCCCCCCGAAAATAATAGTTAAATCAAGGAGATTAACATGGCCAATTTAA