SecReT6
Protein ID: 378955590
SecReT6 ID542
T6SS typei1
Gene symbol-
Locus tagSPUL_1918
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
Repliconchromosome [GenBank: NC_016831] [Browse all T6SS(s) in this replicon]
Location [Strand]1910143..1910622 [+]
Producthypothetical protein
NoteTssD
UniProt IDG7T7R7
KEGG IDsel:SPUL_1918
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-29, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|378955590|ref|YP_005213077.1| hypothetical protein SPUL_1918 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078]
MANLIYLTLNGEKQGLISAGCCSLDSIGNKAQLLHLDHIMVYELTHGLSRDQNVNHHSVTIKKPVDKSSP
LLGKAINDNEILTCTFDFYRTNRFGINEKYYKLELKNARISDINFSIAHVVIDSEAQPQESISFIYESIN
WEHCIAGTSAFSLWDERVF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|378953804|ref|NC_016831.1|:1910143-1910622 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078 chromosome, complete genome
ATGGCCAATTTAATTTATTTAACACTGAACGGTGAAAAGCAAGGATTGATTTCAGCAGGTTGTTGTTCCC
TTGACTCTATCGGTAATAAAGCACAGTTACTGCACCTTGATCATATTATGGTATATGAACTGACACATGG
GTTAAGTCGGGATCAAAATGTCAATCATCATTCAGTTACGATAAAAAAACCTGTCGATAAATCATCTCCT
TTACTGGGAAAAGCAATTAACGATAATGAAATATTGACCTGCACTTTTGATTTTTATCGAACAAATCGAT
TTGGTATTAATGAAAAATATTACAAACTGGAATTAAAAAACGCCCGAATTAGTGATATTAATTTCTCGAT
TGCGCATGTAGTCATTGACAGTGAAGCACAACCTCAGGAAAGTATTTCTTTTATATATGAATCCATAAAC
TGGGAACACTGTATTGCCGGGACCAGTGCATTCAGTTTATGGGATGAGAGGGTGTTTTAG