SecReT6
Protein ID: 378960765
SecReT6 ID543
T6SS typei3
Gene symbol-
Locus tagSTBHUCCB_27390
StrainSalmonella enterica subsp. enterica serovar Typhi str. P-stx-12
Repliconchromosome [GenBank: NC_016832] [Browse all T6SS(s) in this replicon]
Location [Strand]2662247..2662732 [-]
Producthypothetical protein
NoteTssD
UniProt IDH6NWN2
KEGG IDsex:STBHUCCB_27390
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|378960765|ref|YP_005218251.1| hypothetical protein STBHUCCB_27390 [Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|378958130|ref|NC_016832.1|:c2662732-2662247 Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 chromosome, complete genome
ATGGCTTATGACATTTTTTTAAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACTAATCTGGATTTTGATCACTATATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTCGAGCTTTCTTTCAGCACTGTGAAACAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGTTACGACTTCAAGGCGAACAAAGAAATTTAA