SecReT6
Protein ID: 378960767
SecReT6 ID543
T6SS typei3
Gene symbol-
Locus tagSTBHUCCB_27430
StrainSalmonella enterica subsp. enterica serovar Typhi str. P-stx-12
Repliconchromosome [GenBank: NC_016832] [Browse all T6SS(s) in this replicon]
Location [Strand]2665352..2665894 [-]
ProductType VI secretion protein
NoteTssB
UniProt IDH6NWN4
KEGG IDsex:STBHUCCB_27430
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-60, Aligned region: 11..164
Protein Sequence: 180 a.a.     [Download]
>gi|378960767|ref|YP_005218253.1| Type VI secretion protein [Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12]
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDRKFLDIDIDNF
NERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALNQLLEARTQLANLQTYMDGKA
GAENLVNKLLQDPTLLKTLANAPKSAATQQGVSADNESAE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|378958130|ref|NC_016832.1|:c2665894-2665352 Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 chromosome, complete genome
ATGGCTATCAACAATAGCGCGCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATTGAATATG
ACGTAGAGATTTACGGTTCCGAGAAAAAAATCGAGCTGCCGTTCGTGATGGCGGTGCTGGCCGATCTGGC
CGGGAAACCGCGTGAAGAACTGCCGCCGGTGACGGATCGCAAATTCCTCGATATTGATATTGATAACTTC
AATGAGCGCATGAAAGCCATTGCGCCGCGCGTGGCGTTCGCTGTGCCGAATACGCTGACGGGTGAAGGTC
AGTTGATGGTCGATATCACCCTGGAAAATATGGACGACTTTTCGCCGGCACAGATTGCCCGCAAGGTGGA
CGCCCTGAACCAGTTACTGGAAGCCCGCACTCAACTGGCGAACCTCCAGACCTACATGGATGGCAAGGCC
GGGGCGGAAAATCTGGTCAATAAACTGTTGCAGGACCCGACTCTGCTGAAAACGCTGGCGAATGCGCCGA
AATCGGCCGCTACCCAGCAAGGTGTGTCAGCGGATAATGAATCAGCGGAATAA