SecReT6
Protein ID: 378960771
SecReT6 ID543
T6SS typei3
Gene symbol-
Locus tagSTBHUCCB_27470
StrainSalmonella enterica subsp. enterica serovar Typhi str. P-stx-12
Repliconchromosome [GenBank: NC_016832] [Browse all T6SS(s) in this replicon]
Location [Strand]2670254..2671078 [+]
Producthypothetical protein
NoteTagJ
UniProt IDH6NWN8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.30E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|378960771|ref|YP_005218257.1| hypothetical protein STBHUCCB_27470 [Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12]
MKKTDTLPATLSALLQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWARALHQLQLCARMEAN
YTQEARLYRELVCCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMTHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|378958130|ref|NC_016832.1|:2670254-2671078 Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 chromosome, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGCTACAGGAATACTCTATTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAGGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGGCGCGGGCGCTACACCAGCTTCAGCTCTGTGCCAGGATGGAGGCAAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTTGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGACACGGGCGGG
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTGG
TCACCGGCGGCGTGTATATCTGGCTACCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGTGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCTGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGAGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGACCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA