SecReT6
Protein ID: 378960775
SecReT6 ID543
T6SS typei3
Gene symbol-
Locus tagSTBHUCCB_27510
StrainSalmonella enterica subsp. enterica serovar Typhi str. P-stx-12
Repliconchromosome [GenBank: NC_016832] [Browse all T6SS(s) in this replicon]
Location [Strand]2674477..2674893 [+]
ProductImpA-related N-family protein
NoteTssA
UniProt IDH6NWP2
KEGG IDsex:STBHUCCB_27510
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.40E-19, Aligned region: 49..108
Protein Sequence: 138 a.a.     [Download]
>gi|378960775|ref|YP_005218261.1| ImpA-related N-family protein, partial [Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12]
MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIRVL
ILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAARWITKA
 
Nucleotide Sequence: 417 bp     [Download]
>gi|378958130|ref|NC_016832.1|:2674477-2674893 Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 chromosome, complete genome
ATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGGAATACC
TGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCCGGAAGC
CGTGAACTGGCCGGAAATTGAGCGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGGGTGTTG
ATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACACAACTGG
CAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATCCGCAGA
ATCTATTGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCGCTGGATCACGAAGGCGTGA