SecReT6
Protein ID: 378960776
SecReT6 ID543
T6SS typei3
Gene symbol-
Locus tagSTBHUCCB_27520
StrainSalmonella enterica subsp. enterica serovar Typhi str. P-stx-12
Repliconchromosome [GenBank: NC_016832] [Browse all T6SS(s) in this replicon]
Location [Strand]2674893..2675525 [+]
ProductImpA-related N-family protein
NoteTssA
UniProt IDH6NWP3
KEGG IDsex:STBHUCCB_27520
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|378960776|ref|YP_005218262.1| ImpA-related N-family protein, partial [Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12]
MADIRGITLSNSAALHLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQV
WARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPAPAPAGTVMDNAIPARAEDVPPVNAPPGIS
IPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 633 bp     [Download]
>gi|378958130|ref|NC_016832.1|:2674893-2675525 Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12 chromosome, complete genome
ATGGCAGACATTCGCGGTATCACGCTGTCAAACAGTGCCGCCCTGCACCTGCAGGTACGGGACGTGGAGC
GCGCGTTATCCGCCCCTCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCAGACCT
CGAAGCCCGTGGGGCATTACCGCTAGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTG
TGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGC
CTGACGTGGTACAGACAACCACGCCGGAAATCCCTCCGTCGCCAGCGCCAGCGCCAGCTCCCGCAGGCAC
GGTTATGGATAATGCCATTCCTGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCT
ATCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCATTC
GTCGCTGGTTTGAGAGCAGTGAACCCAGCAGCCCGACCATCCCACTATTACGTCAGGCTGAAAGACTGGT
GGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAG
TGA