SecReT6
Protein ID: 378978456
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_22970
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2326237..2326728 [+]
Producthypothetical protein
NoteTssB
UniProt IDG8VZH5
KEGG IDkpm:KPHS_22970
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-52, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|378978456|ref|YP_005226597.1| hypothetical protein KPHS_22970 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHVKENRPLSEREKINVNKNNFNSVLSEF
SPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EAILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2326237-2326728 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGGCTGATACGTTCCAGAATGAAGTCCCCAGGGCGCGCATTAATCTCAAATTATCTCTTCATACCGGCG
GCGCGCAAAAGAAGGTCGAACTGCCGCTCAAACTGCTTACCATTGGCGATTTTAGTCATGTTAAGGAAAA
CCGGCCTTTATCGGAAAGAGAAAAAATCAACGTCAATAAAAATAATTTTAACAGCGTACTTTCGGAATTT
AGCCCGGAAGTTAACCTCTCGGTGCCGAATACGCTGGCCGGCAATGGCGAAGAGGAGAACGTCAGACTGC
GTTTTACCGACATCAAAGATTTTGAACCGGAGCAGGTTGCCCGGCAAATTCCGCAACTCCGCGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCCAATCTGCTCGATAACGCCACTTTCAGAAAAGAGCTT
GAGGCAATCCTGAAAGATCCGGCGCTGTCCCAGGAATTACGCGACGAAATGAGTGCGCTTGCCCCGAAAT
AA