SecReT6
Protein ID: 378978457
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_22980
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2326771..2328315 [+]
ProductEvpB/family type VI secretion protein
NoteTssC
UniProt IDG8VZH6
KEGG IDkpm:KPHS_22980
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-171, Aligned region: 88..510
Protein Sequence: 514 a.a.     [Download]
>gi|378978457|ref|YP_005226598.1| EvpB/family type VI secretion protein [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MSVTTENAPVQGQTTLQENRAGEGVYASLFEKINLTPASRLGDINDFLDDAALSEAPAAERLTAAMQVFM
ERIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWRGLKQLVDNTDYRQNVKTEIL
DVAKDDLRQDFEDAPELIQSGMYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDVALLRNISRVSAAAHM
PFIGAVGPAFFLKETMEEVAAIKDIGNYFDRAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHEKYLWTSAAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIP
SEVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2326771-2328315 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGTCTGTTACCACAGAAAACGCCCCTGTTCAGGGGCAAACCACGCTGCAGGAAAACAGGGCGGGCGAGG
GCGTTTACGCCTCGCTGTTTGAAAAAATTAATCTCACCCCGGCGTCTCGCCTCGGGGATATCAACGACTT
TCTGGACGATGCCGCGCTCTCCGAGGCGCCGGCGGCGGAACGTCTCACCGCGGCGATGCAGGTGTTTATG
GAACGCATCCGCCAGTCCGGCCAGCGGGTGGAAAAGCTCGACAAAACGCTGATCGATCACCATATCGCCG
AGCTGGATTTCCAGATAAGCCGTCAGCTGGACGCGGTGATGCACCATCAGGAGTTTCAGCAGGTCGAATC
CCTGTGGCGCGGCCTCAAACAGCTGGTGGACAACACCGACTATCGGCAGAACGTCAAAACGGAGATCCTC
GACGTCGCCAAAGACGATCTGCGCCAGGACTTTGAGGACGCGCCGGAGCTTATCCAGAGCGGCATGTACT
GGCACACCTATACCGCGGAGTATGACACTCCCGGCGGCGAGCCGATCGGCTCGGTGATCTCGGCCTATGA
GTTCGACGCCAGCCCGCAGGATGTGGCGCTGCTGCGCAATATCTCCCGCGTCTCTGCGGCCGCCCATATG
CCGTTTATCGGCGCCGTCGGCCCGGCCTTCTTCCTGAAAGAGACCATGGAAGAGGTGGCTGCCATTAAGG
ATATCGGCAACTACTTCGATCGTGCGGAATATATCCGCTGGAAGGCGTTTCGCGAAACTGACGATGCCCG
CTACATCGGCCTGGTGATGCCGCGCGTGCTGGGTCGTCTGCCGTACGGTCCGGACACCGTGCCGGTGCGC
AGCTTCAACTATGTCGAGCAGGTGAAGGGCCCGGATCACGAAAAATATCTCTGGACCAGCGCGGCGTTCT
CCTTCGCATCTAATATGGTGAAGAGCTTTGTTAACAACGGCTGGTGCGTGCAAATTCGCGGTCCGCAGGC
GGGCGGCGCGGTGAAAGATTTGCCTATCCATCTGTACGATCTGGGCACCGGCAACCAGGTGAAGATCCCT
TCCGAGGTGATGATCCCGGAAACGCGGGAGTTTGAGTTCGCCAGCCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAATCGCGATTACGCCTGCTTCTTCTCGGCCAACTCCGCGCAGAAACCGGCGCTGTACGATACCGC
CGACGCCACCGCCAACAGCCGTATCAACGCGCGTCTGCCTTACATCTTCCTGCTGTCGCGCATCGCGCAC
TACCTGAAGATGATCCAGCGCGAAAATATCGGCACCACCAAGGACCGGCGTCTGCTGGAGCTGGAGCTGA
ACACCTGGGTGCGGAGCCTGGTGACCGAAATGACCGACCCCGGCGACGAGCTGCAGGCCTCCCATCCGCT
GCGCGATGCCAGCGTGGTGGTGGAAGATATCGAGGATAACCCGGGCTTCTTCCGCGTGAAGCTGTACGCG
GTGCCGCACTTCCAGGTCGAGGGGATGGACGTCAATCTGTCGCTGGTTAGCCAGATGCCAAAGGCGAAGG
CGTAG