SecReT6
Protein ID: 378978458
SecReT6 ID548
T6SS typei2
Gene symbol-
Locus tagKPHS_22990
StrainKlebsiella pneumoniae subsp. pneumoniae HS11286
Repliconchromosome [GenBank: NC_016845] [Browse all T6SS(s) in this replicon]
Location [Strand]2328325..2329668 [+]
Producthypothetical protein
NoteTssK
UniProt IDG8VZH7
KEGG IDkpm:KPHS_22990
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-134, Aligned region: 19..444
Protein Sequence: 447 a.a.     [Download]
>gi|378978458|ref|YP_005226599.1| hypothetical protein KPHS_22990 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRLQAHRLQVRFQ
DGTMIDTDNADALPSALSLDGAPGEAVIVLALPLMQANGGNCLKPEEVAERPVRFRQRWRDVRNQFGDDT
RQIAVIQPELTLRFAHQDNSDYLTCPLVRLQRDSQGAWLIDETFLSPLLQIQGSRWLATQLEQLLVQLRA
RLTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSL
THQANAVPIYQHDQLNAVFPPLFDLLSDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLS
VRSSVPVAQLQEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|378976159|ref|NC_016845.1|:2328325-2329668 Klebsiella pneumoniae subsp. pneumoniae HS11286 chromosome, complete genome
ATGATGAAAACGGAACGTCCGTTGTGGGGCCGGGGCATTATGGTGTCGCCTCAGCATTTTCAACAGCAGG
CTGCGTATGCAGCCTGGACTGCGGAAGTGATTGCCCGGATGGGTCTTAACCACCCCTGGGGAGTGGTTGA
GGCGACCTTCGAACCAGAGATGCTCAAACTGGGCCGCCTGCAGGCTCACAGGCTGCAGGTCCGGTTCCAG
GATGGCACGATGATTGATACGGACAATGCCGATGCGCTGCCGTCCGCGCTGTCGCTGGACGGCGCGCCCG
GCGAGGCGGTGATCGTGCTGGCGCTGCCCCTGATGCAGGCGAATGGCGGCAACTGTCTGAAGCCGGAGGA
GGTTGCCGAAAGGCCGGTGCGCTTCCGGCAGCGCTGGCGCGATGTCCGTAACCAGTTTGGGGATGATACC
CGGCAGATTGCCGTCATACAGCCGGAGCTGACCCTCCGCTTCGCCCACCAGGACAACAGCGATTACCTGA
CCTGTCCGCTTGTTCGCCTGCAGCGGGACTCGCAGGGGGCCTGGCTTATCGACGAGACGTTTCTCTCGCC
GCTGCTGCAGATCCAGGGCAGCCGCTGGCTGGCGACGCAGCTTGAACAGCTGCTCGTCCAGCTCCGGGCT
CGTCTGACGCGCCTGATGGCCATGCGTCGCGAAAGCAATGAACGGATGGCTGATTTTGCCGTAGCCGATG
TCTCTCTGTTCTGGTTGCTGAATGCGCTGAACAGCGCCGAACCGGTGCTGGGGTACTTTCTGCGTTACCG
GCAAAGCCCGCCGGAACGCCTCTACCCGGAGCTGGCGCGCCTGGCTGGTAGCCTGCTGACCTTTTCGCTC
ACCCATCAGGCGAATGCCGTCCCGATCTATCAGCATGACCAGCTGAACGCGGTTTTTCCGCCGCTGTTTG
ATTTACTGAGCGACCTGCTGGAGGCGAGCCTGCCATCGCGGGTGGTGGCGATTGCCCTGGAGCATGATGT
CCGGCTGCACTTCTGGCAGGCGCGTCTGCACGATGCCCGGCTGCGGGAAGGGGCTGATTACTACCTGTCG
GTTCGTTCGTCGGTACCGGTCGCCCAACTGCAGGAGCAGTTTCCGCGCCAGTGCAAAGTGGGCAGTCCGG
ATCATGTCAAAGCCATCGTCAACTCCTCGCGGACAGGGGTGCCCCTCACGCCATTGCGTCATGTGCCGGC
GGCGATCCCGCTGCGTCTGGAAAATCAGTATTTCAGCCTCGATGTGTCCCACCCTCTGGCAACGGAAATG
CTGCAGAGCGGCACCTGTATGTTTTACGTCCCGGGGATGCTCGGTGAGCCTGAACTTGAACTTTTTGCGG
TACTACGAACGTGA